SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G1R5A0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G1R5A0
Domain Number 1 Region: 456-723
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 4.91e-58
Family Eukaryotic proteases 0.0000317
Further Details:      
 
Domain Number 2 Region: 381-474
Classification Level Classification E-value
Superfamily Kringle-like 1.01e-33
Family Kringle modules 0.00013
Further Details:      
 
Domain Number 3 Region: 204-288
Classification Level Classification E-value
Superfamily Kringle-like 3.14e-33
Family Kringle modules 0.00015
Further Details:      
 
Domain Number 4 Region: 111-202
Classification Level Classification E-value
Superfamily Kringle-like 7.49e-31
Family Kringle modules 0.00024
Further Details:      
 
Domain Number 5 Region: 295-378
Classification Level Classification E-value
Superfamily Kringle-like 1.52e-30
Family Kringle modules 0.00021
Further Details:      
 
Domain Number 6 Region: 34-121
Classification Level Classification E-value
Superfamily Hairpin loop containing domain-like 1.45e-17
Family Hairpin loop containing domain 0.0098
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) G1R5A0
Sequence length 725
Comment (tr|G1R5A0|G1R5A0_NOMLE) Macrophage stimulating 1 {ECO:0000313|Ensembl:ENSNLEP00000008372} KW=Complete proteome; Reference proteome OX=61853 OS=leucogenys). GN=MST1 OC=Catarrhini; Hylobatidae; Nomascus.
Sequence
MGLWWVTVQPPARRMGWLPLLLLLTQCLGVPGQRSPLNDFQVLRGTELQHLLHAVVPGPW
QEDVADAEECAGRCGPLMDCRAFHYNVSSHGCQLLPWTQHSPHTRLRRSGRCDLFQKKDY
IRTCIMNNGVGYRGTMATTVGGLPCQAWSHKFPNDHKYTPTLRNGLEENFCRNPDGDPGG
PWCYTTDPAVRFQSCGIKSCREAACVWCNGEDYRGAVDRTESGRECQRWDLQHPHQHPFE
PGKFLDQGLDDNYCRNPDGSERPWCYTTDPQIEREFCDLPRCGSEAQPRHEATTVSCFRG
KGEGYRGTANTTTAGVPCQRWDAQIPHQHRFTPEKYACKDLRENFCRNPDGSEAPWCFTL
RPGMRVAFCYQIRRCADDVRPQDCYHGAGEQYRGKVSKTRKGVQCQRWSAETPHKPQFTF
TSEPHAQLEENFCRNPDGDSHGPWCYTMDPRTPFDYCALRRCADDQPPSILDPPDQVQFE
KCGKRVDQLDQRRSKLRVVGGHPGNSPWTVSLRNRQGQHLCGGSLVKEQWILTARQCFSS
CHMPLTGYEVWLGTLFQNPQHGEPGLQRVPVAKMVCGPSGSQLVLLKLERSVTLNQRVAL
ICLPPEWYVVPAGTKCEIAGWGETKGTGNDTVLNVAWLNVISNQECNIKHRGRVRESEMC
TEGLLAPVGACEGDYGGPLACFTHNCWVLEGIIIPNRVCARSRWPAVFTRVSVFVDWIHK
VMRLG
Download sequence
Identical sequences G1R5A0
ENSNLEP00000008372 ENSNLEP00000008372 XP_003257123.1.23891 XP_012352598.1.23891

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]