SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G1R6Q6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G1R6Q6
Domain Number 1 Region: 185-266
Classification Level Classification E-value
Superfamily Thyroglobulin type-1 domain 9.94e-26
Family Thyroglobulin type-1 domain 0.00013
Further Details:      
 
Domain Number 2 Region: 24-106
Classification Level Classification E-value
Superfamily Growth factor receptor domain 3.77e-24
Family Growth factor receptor domain 0.0000532
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) G1R6Q6
Sequence length 272
Comment (tr|G1R6Q6|G1R6Q6_NOMLE) Insulin like growth factor binding protein 5 {ECO:0000313|Ensembl:ENSNLEP00000008878} KW=Complete proteome; Reference proteome OX=61853 OS=leucogenys). GN=IGFBP5 OC=Catarrhini; Hylobatidae; Nomascus.
Sequence
MVSLTAVLLLLAAYAGPAQSLGSFVHCEPCDEKALSMCPPSPLGCELVKEPGCGCCMTCA
LAEGQSCGVYTERCAQGLRCLPRQDEEKPLHALLHGRGVCLNEKSYREQVKIERDSREHE
EPTTSEMAEETYSPKIFRPKHTRISELKAEAVKKDRRKKLTQSKFVGGAENTAHPRVISA
PEMRQESEQGPCRRHMEASLQELKASPRMVPRAVYLPNCDRKGFYKRKQCKPSRGRKRGI
CWCVDKYGMKLPGMEYVDGDFQCHTFDSSNVE
Download sequence
Identical sequences G1R6Q6
ENSNLEP00000008878 XP_003254106.1.23891 ENSNLEP00000008878

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]