SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G1R707 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G1R707
Domain Number 1 Region: 25-103
Classification Level Classification E-value
Superfamily Immunoglobulin 2.77e-27
Family I set domains 0.0000188
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) G1R707
Sequence length 182
Comment (tr|G1R707|G1R707_NOMLE) CD3g molecule {ECO:0000313|Ensembl:ENSNLEP00000008979} KW=Complete proteome; Reference proteome OX=61853 OS=leucogenys). GN=CD3G OC=Catarrhini; Hylobatidae; Nomascus.
Sequence
MEQGKGLAVLILAIILLQGTLAQSIKGNHLVKVYDYQEDGSVLLTCDAKASNITWFKDGK
MIDFLSANKKKWNLGSNTKDPRGMYQCKGSQDKSKPLQVYYRMCQNCIELNAATISGFLF
AEIISIFFLAVGVYFIAGQDGVRQSRASDKQTLLPNDQLYQPLKDREDDQYSHIQGNQLR
RN
Download sequence
Identical sequences G1R707
ENSNLEP00000008979 ENSNLEP00000008979

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]