SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G1R785 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G1R785
Domain Number 1 Region: 154-237
Classification Level Classification E-value
Superfamily Immunoglobulin 8.82e-16
Family I set domains 0.028
Further Details:      
 
Domain Number 2 Region: 36-144
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000000421
Family V set domains (antibody variable domain-like) 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) G1R785
Sequence length 416
Comment (tr|G1R785|G1R785_NOMLE) Hepatic and glial cell adhesion molecule {ECO:0000313|Ensembl:ENSNLEP00000009057} KW=Complete proteome; Reference proteome OX=61853 OS=leucogenys). GN=HEPACAM OC=Catarrhini; Hylobatidae; Nomascus.
Sequence
MKRERGALSRASRALRLAPFVYLLLIQTDPLEGVNITSPVRLIHGTVGKSALLSVQYSST
SSDRPVVKWQLKRDKPVTVVQSIGTEVIGTLRPDYRDRIRLFENGSLLLSDLQLADEGTY
EVEISITDDTFTGEKTINLTVDVPISRPQVLVASTTVLELSEAFTLNCSHENGTKPSYTW
LKDGKPLLNDSRMLLSPDQKVLTITRVLMEDDDLYSCVVENPISQGRSLPVKITVYRRSS
LYIILSTGGIFLLVTLVTVCACWKPSKRKQKKLEKQSSLEYMDQNDDRLKPEADTLPRSG
EQERKNPMALYILKDKDSPEPEENPAPEPRSATEPGPPGYSVSPAVPGRSPGLPIRSARR
YPRSPARSPATGRTHTSPPRAPSSPGRSRSASRTLRTAGVHIIREQDEAGPVEISA
Download sequence
Identical sequences G1R785
ENSNLEP00000009057 ENSNLEP00000009057 XP_003253384.1.23891

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]