SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for G1RAP7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G1RAP7
Domain Number 1 Region: 131-181
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000167
Family EGF-type module 0.0063
Further Details:      
 
Domain Number 2 Region: 89-124
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000974
Family EGF-type module 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) G1RAP7
Sequence length 406
Comment (tr|G1RAP7|G1RAP7_NOMLE) Collagen and calcium binding EGF domains 1 {ECO:0000313|Ensembl:ENSNLEP00000010294} KW=Complete proteome; Reference proteome OX=61853 OS=leucogenys). GN=CCBE1 OC=Catarrhini; Hylobatidae; Nomascus.
Sequence
MVPPPPSRGGAARGQLGRSLGPLLLLLALGHTWTYREEPEDGDREICSESRIATTKYPCL
KSSGELTTCYRKKCCKGYKFVLGQCIPEDYDVCAEAPCEQQCTDNFGRVLCTCYPGYRYD
RERHRKREKPYCLDIDECASSNGTLCAHICINTLGSYRCECREGYIREDDGKTCTRGDKY
PNDTGHEKSENVVKAGTCCATCKEFYQMKQTVLQLKQKIALLPNNAADLGKYITGDKVLA
SNAYLPGPPGLPGGQGPPGSPGPKGSPGFPGMPGPPGQPGPRGSMGPMGPSPDLSHIKQG
RRGPVGPPGAPGRDGSKGERGAPGPRGSPGPPGSFDFLLLMLADIRNDITELQEKVFGHR
THSSAEEFPLPQEFPSYPEAMDLGSGDDHPRRTETRDLRAPRDFYP
Download sequence
Identical sequences G1RAP7
ENSNLEP00000010294 XP_003264333.1.23891 ENSNLEP00000010294

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]