SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G1RCP1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G1RCP1
Domain Number 1 Region: 19-128
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000000199
Family V set domains (antibody variable domain-like) 0.0088
Further Details:      
 
Domain Number 2 Region: 147-223
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000207
Family C2 set domains 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) G1RCP1
Sequence length 290
Comment (tr|G1RCP1|G1RCP1_NOMLE) CD274 molecule {ECO:0000313|Ensembl:ENSNLEP00000010990} KW=Complete proteome; Reference proteome OX=61853 OS=leucogenys). GN=CD274 OC=Catarrhini; Hylobatidae; Nomascus.
Sequence
MRIFAVFIFMTYWHLLNAFTVTVPKDLYVVEYGSNMTIECKFPVEKQLDLAALIVYWEME
DKNIIQFVHGEEDLKVQHSSYRQRARLLKDQLSLGNAALQITDVKLQDAGVYRCMISYGG
ADYKRITVKVNAPYNKINQRILVVDPVTSEHELTCQAEGYPKAEVIWTSSDHQVLSGKTT
TTNSKREEKLFNVTSTLRINTTTNEIFYCTFRRSDPEENHTAELVIPELPLAHPPNERTH
LVILGAILVFLGVALTFIFCLRKGRMMDVKKCGIRDTNSKKQSDTQLEET
Download sequence
Identical sequences G1RCP1
ENSNLEP00000010990 ENSNLEP00000010990 XP_003273874.1.23891

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]