SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G1RD59 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G1RD59
Domain Number 1 Region: 400-545
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.37e-26
Family MAM domain 0.0015
Further Details:      
 
Domain Number 2 Region: 82-209
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000004
Family Growth factor receptor domain 0.014
Further Details:      
 
Domain Number 3 Region: 219-254
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000105
Family EGF-type module 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) G1RD59
Sequence length 554
Comment (tr|G1RD59|G1RD59_NOMLE) EGF like domain multiple 6 {ECO:0000313|Ensembl:ENSNLEP00000011158} KW=Complete proteome; Reference proteome OX=61853 OS=leucogenys). GN=EGFL6 OC=Catarrhini; Hylobatidae; Nomascus.
Sequence
MPLPWSLALPLLLPWVAGGFGNAASARHHGLLASARQPGVCHYGTRLACCYGWRRNSKGV
CEATCEPGCKFGECVGPNKCRCFPGYTGKTCSQDVNECGMKPRPCQHRCVNTHGSYKCFC
LSGHMLMPDATCVNSRTCAMINCQYGCEDTEEGPQCLCPSSGLRLAPNGRVCLDIDECAS
GKAICPYNRRCVNTFGSYYCKCHIGFELQYISGRYDCIDINECTMDSHTCSHHANCFNTQ
GSFKCKCKQGYKGNGLRCSAIPENSVKEVLRAPGTIKDRIKKLLAHKNSMKKKVKIKNVT
PEPTRTPTPKMNLQPFNYEESVSRGRNSHGDKKGNEEKMKEGLEEEKREEKALKNDIEER
SLRGDVFFPKVNEAGEFGLVLVQRKALTSKLEHKADLNISVDCSFNHGICDWKQDREDDF
DWNPADRDNAIGYYMAVPALAGHKKDIGRLKLLLPDLQPQSNFCLLFDYRLAGDKVGKLR
VLVKNSNNALAWEETTSEDEKWKTGKIQLYQGTDATKSIIFEAERGKGKTGEIAVDGVLL
VSGLCPDSLLSVDD
Download sequence
Identical sequences G1RD59
ENSNLEP00000011158 XP_003261082.1.23891 ENSNLEP00000011158

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]