SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G1RF01 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G1RF01
Domain Number 1 Region: 1-131
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 7.89e-38
Family Dual specificity phosphatase-like 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) G1RF01
Sequence length 228
Comment (tr|G1RF01|G1RF01_NOMLE) Dual specificity phosphatase 15 {ECO:0000313|Ensembl:ENSNLEP00000011801} KW=Complete proteome; Reference proteome OX=61853 OS=leucogenys). GN=DUSP15 OC=Catarrhini; Hylobatidae; Nomascus.
Sequence
VLPGLYLGNFIDAKDLDQLGRNKITHIISIHESPQPLLQDITYLRIPVADTPEVPIKKHF
KECINFIHCCRLNGGNCLVHCFAGISRSTTIVTAYVMTVTGLGWRDVLEAIKATRPIANP
NPGFRQQLEEFGWGSSRKLRRQLEERFGESPFRDEEELRALLPLCKRCRQGSATSASSAG
PHSAASEGTLQRLVPRTPREAHRPLPLLARVKQTFSCLPRCLSRKGGK
Download sequence
Identical sequences G1RF01
ENSNLEP00000011801

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]