SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G1RGS2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G1RGS2
Domain Number 1 Region: 44-171
Classification Level Classification E-value
Superfamily TPR-like 2.14e-17
Family Tetratricopeptide repeat (TPR) 0.0038
Further Details:      
 
Domain Number 2 Region: 846-885
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000117
Family HkH motif-containing C2H2 finger 0.075
Further Details:      
 
Domain Number 3 Region: 904-932
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.0000455
Family CCCH zinc finger 0.004
Further Details:      
 
Domain Number 4 Region: 768-801
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.0000471
Family CCCH zinc finger 0.0059
Further Details:      
 
Weak hits

Sequence:  G1RGS2
Domain Number - Region: 630-660
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.014
Family CCCH zinc finger 0.0077
Further Details:      
 
Domain Number - Region: 504-532
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.0608
Family CCCH zinc finger 0.0069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) G1RGS2
Sequence length 971
Comment (tr|G1RGS2|G1RGS2_NOMLE) Zinc finger CCCH-type containing 7A {ECO:0000313|Ensembl:ENSNLEP00000012422} KW=Complete proteome; Reference proteome OX=61853 OS=leucogenys). GN=ZC3H7A OC=Catarrhini; Hylobatidae; Nomascus.
Sequence
MSSVSEERRKRQQNIKEGLQFIQSPLSYPGTQEQYAVYLRALVRNLFNEGNDVYRERDWN
NSISQYTEALNIADYAKSEEILIPKEIIEKLYINRIACYSNMGFHDKVLEDCNIVLSLNA
SNCKALYRKSKALSDLGRYKKAYDAVAKCSLAVPQDEHVIKLTQELAQKLGFKIRKAYVR
AELSLKSVPGDGATKALNHSVEDIEPDLLTPRQEAVPVVSLPAPSFSHEVGSELASVPVM
PLTSILPLQVEESALPSAVLANGGKMPFTMPEAFLDDGDMVLGDELDDLLDSAPETNETV
MPSALVRGPLQTASVSPSMPFSASLLGTLPIGARYAPPPSFSEFYPPLTSSLEDFCSSLN
SFSMSESKRDLSTSTSREGTPLNNSNSSLLLMNGPGSLFASENFLGISSQPRNDFGNFFG
SAVTKPSSSVTPRHPLEGTHELRQACQICFVKSGPKLMDFTYHANIDHKCKKDILIGRIK
NVEDKSWKKIRPRPTKTNYEGPYYICKDVAAEEECRYSGHCTFAYCQEEIDVWTLERKGA
FSREAFFGGNGKINLTVFKLLQEHLGEFIFLCEKCFDHKPRMISKRNKDNSTACSHPVTK
HEFEDNKCLVHILRETTVKYSKIRSFHGQCQLDLCRHEVRYGCLREDECFYAHSLVELKV
WIMQNETGISHDAIAQESKRYWQNLEANVPGAQVLGNQIMPGFLNMKIKFVCAQCLRNGQ
VIEPDKNRKYCSAKARHSWTKDRRAMRVMSIERKKWMNIRPLPTKKQMPLQFDLCNHIAS
GKKCQYVGNCSFAHSPEEREVWTYMKENGIQDMEQFYELWLKSQKNEKSEDVASQSNKEN
GKQIHMPTDYAEVTVDFHCWMCGKNCNSEKQWQGHISSEKHKEKVFHTEDDQYCWQHRFP
TGYFSICDRYMNGTCPEGNSCKFAHGNAELHEWEERRDALKMKLNKARKDHLIGPNDNDF
GKYSFLFKDLN
Download sequence
Identical sequences G1RGS2
ENSNLEP00000012422 ENSNLEP00000012422 XP_012352846.1.23891 XP_012352847.1.23891

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]