SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G1RH48 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G1RH48
Domain Number 1 Region: 36-370
Classification Level Classification E-value
Superfamily L domain-like 4.82e-61
Family Ngr ectodomain-like 0.01
Further Details:      
 
Domain Number 2 Region: 420-504
Classification Level Classification E-value
Superfamily Immunoglobulin 2.26e-20
Family I set domains 0.0064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) G1RH48
Sequence length 594
Comment (tr|G1RH48|G1RH48_NOMLE) Leucine rich repeat and Ig domain containing 4 {ECO:0000313|Ensembl:ENSNLEP00000012548} KW=Complete proteome; Reference proteome OX=61853 OS=leucogenys). GN=LINGO4 OC=Catarrhini; Hylobatidae; Nomascus.
Sequence
MDAATAPKQAWPPWPPLLFLLLLLPAGSGGSCPAVCDCTSQPQAVLCGHRQLEAVPGGLP
LDTELLDLSGNRLWGLQRGMLSRLSLLQELDLSYNQLSTLEPGAFHGLQSLITLRLQGNR
LRIMGPGVFSGLSALTLLDLRLNQIVLFLDGAFGELGSLQKLEVGDNHLVFVAPGAFAGL
AKLSTLTLERCNLSTVPGLALAHLPALVALRLRELDIGRLPAGALRGLGQLKELEIHLWP
SLEALDPGSLVGLNLSSLAITRCNLSSVPFQALYHLSFLRVLDLSQNPISAIPARRLSPL
VRLQELRLSGACLTSIAAHAFHGLSAFHLLDVADNALQTLEETAFPSPEKLVTLRLSGNP
LTCDCRLLWLLRLRRRLDFGTSPPACAGPQHVQGKSLREFSDILPPGHFTCKPALIRKSG
PRWVIAEEGGHAVFSCSGDGDPAPTVSWMRPHGAWLGRAGRVRVLEDGTLEIRSVQLRDR
GAYVCVVSNVAGNDSLRTWLEVIQVEPPNGTLSDPNITVPGIPGPFFLDSRGVAMVLAVG
FLPFLTSVTLCFGLIALWSKGKGRVKHHMTFDFVAPRPSGDKNSGGNRVTAKLF
Download sequence
Identical sequences G1RH48
ENSNLEP00000012548 XP_003259301.1.23891 XP_012367031.1.23891 ENSNLEP00000012548

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]