SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G1RIY4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G1RIY4
Domain Number 1 Region: 431-487
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.46e-24
Family Classic zinc finger, C2H2 0.0032
Further Details:      
 
Domain Number 2 Region: 487-543
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.66e-24
Family Classic zinc finger, C2H2 0.0064
Further Details:      
 
Domain Number 3 Region: 319-375
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.47e-23
Family Classic zinc finger, C2H2 0.0033
Further Details:      
 
Domain Number 4 Region: 9-69
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 1.57e-21
Family KRAB domain (Kruppel-associated box) 0.0016
Further Details:      
 
Domain Number 5 Region: 375-431
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.77e-21
Family Classic zinc finger, C2H2 0.0075
Further Details:      
 
Domain Number 6 Region: 262-319
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.59e-19
Family Classic zinc finger, C2H2 0.014
Further Details:      
 
Domain Number 7 Region: 532-584
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 8.34e-19
Family Classic zinc finger, C2H2 0.0075
Further Details:      
 
Domain Number 8 Region: 130-168
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000629
Family Classic zinc finger, C2H2 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) G1RIY4
Sequence length 632
Comment (tr|G1RIY4|G1RIY4_NOMLE) Zinc finger protein 792 {ECO:0000313|Ensembl:ENSNLEP00000013191} KW=Complete proteome; Reference proteome OX=61853 OS=leucogenys). GN=ZNF792 OC=Catarrhini; Hylobatidae; Nomascus.
Sequence
MAAAALRDPSQSCVTFEDVTIYFSQEEWVLLDEAQRLLYCDVMLENFALIASLGLISFRS
HIVSQLEMGKEPWVPDSVDMTSAMARGAYGRPGSDFCRGTEDKDLPSEHNVSVEGVAQDK
SPEATLCPQKTCLCDICGLHLKDILRLAEHQTTHPRQKPFVCEAYVKGSEFSADLPQKQV
QQNVHNPIRREEGQASPVKTCRGHTSDQLSTCREGGKDLVATAGFLQCEVTPSDGEPHKA
TEGVVDFHIALRHNKCCESGDAFNDKSTLVQHQRIHSRERPYECSKCGIFFTYAADLTQH
QKVHNRGKPYECCECGKFFSQHSSLVKHRRVHTGESPHVCGDCGKFFSRSSNLIQHKRVH
TGEKPYECSDCGKFFSQRSNLIHHKRVHTGRSAHECSECGKSFNCNSSLIKHWRVHTGER
PYKCNECGKFFSHIASLIQHQIVHTGERPHRCGECGKAFSRSSDLMKHQRVHTGERPYEC
NECGKLFSQSSSLNSHRRLHTGERPYQCSECGKFFNQSSSLSNHRRLHTGERPYECSECG
KTFRQRSNLRQHLKVHKPDRPYECSECGKAFNQRPTLIRHQKIHTRERSTENVLLPSSQH
TPEISSENRPYEGAVNYKLKLVHPSTHPGEVP
Download sequence
Identical sequences G1RIY4
ENSNLEP00000013191 ENSNLEP00000013191 XP_003280050.1.23891

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]