SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G1RJR0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G1RJR0
Domain Number 1 Region: 199-235
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.0000000103
Family Retrovirus zinc finger-like domains 0.0039
Further Details:      
 
Domain Number 2 Region: 63-87
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.000000144
Family CCCH zinc finger 0.0045
Further Details:      
 
Domain Number 3 Region: 145-172
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.0000392
Family CCCH zinc finger 0.004
Further Details:      
 
Weak hits

Sequence:  G1RJR0
Domain Number - Region: 38-59
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.000916
Family CCCH zinc finger 0.0058
Further Details:      
 
Domain Number - Region: 119-143
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.00392
Family CCCH zinc finger 0.0069
Further Details:      
 
Domain Number - Region: 91-119
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.0262
Family CCCH zinc finger 0.0058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) G1RJR0
Sequence length 244
Comment (tr|G1RJR0|G1RJR0_NOMLE) Cleavage and polyadenylation specific factor 4 {ECO:0000313|Ensembl:ENSNLEP00000013467} KW=Complete proteome; Reference proteome OX=61853 OS=leucogenys). GN=CPSF4 OC=Catarrhini; Hylobatidae; Nomascus.
Sequence
MQEIIASVDHIKFDLEIAVEQQLGAQPLPFPGMDKSGAAVCEFFLKAACGKGGMCPFRHI
SGEKTVVCKHWLRGLCKKGDQCEFLHEYDMTKMPECYFYSKFGECSNKECPFLHIDPESK
IKDCPWYDRGFCKHGPLCRHRHTRRVICVNYLVGFCPEGPSCKFMHPRFELPMGTTEQPP
LPQQTQPPAKQRTPQVIGVMQSQNSSAGNRGPRPLEQVTCYKCGEKGHYANRCTKGHLAF
LSGQ
Download sequence
Identical sequences A0A2J8RUA5 A0A2K6QY62 G1RJR0 H9FP23 U3C1K3
ENSNLEP00000013467 ENSP00000395311 NP_001075028.1.87134 NP_001075028.1.92137 NP_001244547.1.72884 XP_003278115.1.23891 XP_003934278.1.74449 XP_004045873.1.27298 XP_005549197.1.63531 XP_008016855.1.81039 XP_010374073.1.97406 XP_011767164.1.29376 XP_011799192.1.43180 XP_011841186.1.47321 XP_011912508.1.92194 XP_012310941.1.9421 XP_017389177.1.71028 gi|125987603|ref|NP_001075028.1| ENSP00000395311 1870 hsi002004475.2 hsi002004475.3

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]