SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G1RPI2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G1RPI2
Domain Number 1 Region: 433-472,505-565
Classification Level Classification E-value
Superfamily PUA domain-like 1.39e-24
Family Hypothetical protein TTHA0113 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) G1RPI2
Sequence length 581
Comment (tr|G1RPI2|G1RPI2_NOMLE) Thyroid hormone receptor interactor 4 {ECO:0000313|Ensembl:ENSNLEP00000015146} KW=Complete proteome; Reference proteome OX=61853 OS=leucogenys). GN=TRIP4 OC=Catarrhini; Hylobatidae; Nomascus.
Sequence
MAVAGAVSGEPLVHWCTQQLRKTFGLDVSEEIIQYVLSIESAEEIQEYVTDLLQGNEGKK
GQFIEELITKWQKNDQELISDPLQQCFKKDEILDGQKSGDHLKRGRKKGRNRQEVPAFTE
PDMTAEVKTPFDLAKAQENSNSVKKKTKFVNLYTREGQDRLAVLLPGRHPCDCLGQKHKL
INNCLICGRIVCEQEGSGPCLFCGTLVCTHEEQDILQRDSNKSQKLLKKLMSGVENSGKV
DIYTKDLLPHQELRIKSGLEKAIKHKDKLLEFDRTSIRRTQVIDDESDYFASDSNQWLSK
LERETLQKREEELRELRHASRLSKKVTIDFAGRKILEEENSLAEYHSRLDETIQAIANGT
LNQPLTKLDRSSEEPLGVLVNPNMYQSPPQWVDYTGAASQKKAFRSSGLGLEFNSFQHQL
RIQDQEFQEGFDGGWCLSIHQPWASLLVRGIKRVEGRSWYTPHRGRLWIAATAKKPSPQE
VSELQATYRLLRGKDVEFPNDYPSGCLLGCVDLIDCLSQKQFKEQFPDISQESDSPFVFI
CKNPQEMVVKFPIKGNPKIWKLDSKIHQGAKKGLMKQNKAV
Download sequence
Identical sequences G1RPI2
ENSNLEP00000015146 ENSNLEP00000015146 XP_004093146.1.23891

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]