SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G1RQD0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G1RQD0
Domain Number 1 Region: 663-814
Classification Level Classification E-value
Superfamily C-type lectin-like 1.49e-43
Family C-type lectin domain 0.00000565
Further Details:      
 
Domain Number 2 Region: 151-265
Classification Level Classification E-value
Superfamily C-type lectin-like 6.8e-43
Family Link domain 0.0051
Further Details:      
 
Domain Number 3 Region: 267-360
Classification Level Classification E-value
Superfamily C-type lectin-like 1.15e-30
Family Link domain 0.0067
Further Details:      
 
Domain Number 4 Region: 44-155
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000273
Family V set domains (antibody variable domain-like) 0.048
Further Details:      
 
Domain Number 5 Region: 814-873
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000431
Family Complement control module/SCR domain 0.0028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) G1RQD0
Sequence length 912
Comment (tr|G1RQD0|G1RQD0_NOMLE) Brevican {ECO:0000313|Ensembl:ENSNLEP00000015444} KW=Complete proteome; Reference proteome OX=61853 OS=leucogenys). GN=BCAN OC=Catarrhini; Hylobatidae; Nomascus.
Sequence
MAQLFLPLLAALVLAQAPAALADVLEGDSSEDRAFHVRIAGDAPLQGVLGGALTIPCHVH
YLRPPPSRLAVLGSPRVKWTFLSGGREAEVLVARGVRVKVNEAYRFRVALPAYPASLTDV
SLALSELRPNDSGIYRCEVQHGIDDSSDAVEVKVKGVVFLYREGSARYAFSFSGAQEACA
RIGAHIATPEQLYAAYLGGYEQCDAGWLSDQTVRYPIQTPREACYGDMDGFPGVRNYGVV
DPDDLYDVYCYAEDLNGELFLGDPPEKLTLEEARAYCQERGAEIATTGQLYAAWDGGLDR
CSPGWLADGSVRYPIVTPSQRCGGGLPGVKTLFLFPNQTGFPNKHSRFNVYCFRDSAQPS
TIPEASNPASDPASDGLEAIVTVTETLEELQLPQEAMESESRGAIYSIPIMEDGGGGSST
PEDPAEAPRTLLEFETQSMVPPTGFSQEEGKALEEEEKYEDEEEKEEEEEEEEDVEDEAL
WAWPSELSSPGPEASLPTEPAAQEESLSQAPARAVLQPGASPLPDGESEASRPPRVHGPP
TETLPTPRERNLASPSPSTLVEAREVGEETGGPELSGVPRGESEETGSSEGAPSLLPATR
APEGTRELEAPSEDNSGRTAPAGTSVQAQPVLPTDSASRGGVAVVPASGDCVPSPCHNGG
TCLEEEEGVRCLCLPGYGGDLCDVGLRFCNPGWDAFQGACYKHFSTRRSWEEAETQCRMY
GAHLASISTPEEQDFINNQYREYQWIGLNDRTIEGDFLWSDGVPLLYENWNPGQPDSYFL
SGENCVVMVWHDQGQWSDVPCNYHLSYTCKMGLVSCGPPPELPLAQVFGRPRLRYEVDTV
LRYRCREGLAQRNLPLIRCQENGRWEAPQISCVPRRPARALHPQKDPEGRQGRLLGRWKA
LLIPPSSPTPGL
Download sequence
Identical sequences G1RQD0
XP_003259516.1.23891 XP_012366646.1.23891 ENSNLEP00000015444 ENSNLEP00000015444

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]