SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G1RQW6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G1RQW6
Domain Number 1 Region: 483-834
Classification Level Classification E-value
Superfamily HD-domain/PDEase-like 1.5e-113
Family PDEase 0.000000248
Further Details:      
 
Domain Number 2 Region: 55-252
Classification Level Classification E-value
Superfamily GAF domain-like 4.14e-31
Family GAF domain 0.00055
Further Details:      
 
Domain Number 3 Region: 238-291,323-459
Classification Level Classification E-value
Superfamily GAF domain-like 4.71e-30
Family GAF domain 0.00093
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) G1RQW6
Sequence length 858
Comment (tr|G1RQW6|G1RQW6_NOMLE) Phosphodiesterase {ECO:0000256|RuleBase:RU363067} KW=Complete proteome; Reference proteome OX=61853 OS=leucogenys). GN=PDE6C OC=Catarrhini; Hylobatidae; Nomascus.
Sequence
MGEINQDAVEKYLEENPQFAKEYFDRKLRVEVLGEIFKNSQVPVQSSMSFSELTQVEESA
LCLELLWTVQEEGGTPEQGVHRALQRLAHLLQADRCSMFLCRSRNGTPEVASRLLDVTPT
SKFEDNLVGPDKEVVFPLDIGIVGWAAHTKKTHNVPDVQKNSHFSDFMDKQTGYVTKNLL
ATPIVVGKEVLAVIMAVNKVNAAEFSKQDEEVFSKYLNFVSIILRLHHTSYMYSIESRRS
QILMWSANKVFEELTDVERQFHKALYTIRTYLNCERYSIGLLDMTKEKEFYDEWPIKLGE
VEPYKGPKTPDGREVNFYKIIDYILHGKEEIKVIPTPPADHWTLISGLPTYVAENGFICN
MMNAPADEYFTFQKGPVDETGWVIKNVLSLPIVNKKEDIVGVATFYNRKDGKPFDEHDEY
ITETLTQFLGWSLLNTDTYDKMNKLENRKDIAQEMLMNQTKATPEEIKSILKFQEKLNVD
VIDDCEEKQLVAILKEDLPDPRSAELYEFRFSDFPLTEHGLIKCGIRLFFEINVVEKFKV
PVEVLTRWMYTVRKGYRAVTYHNWRHGFNVGQTMFTLLMTGRLKKYYTDLEAFAMLAAAF
CHDIDHRGTNNLYQMKSTSPLARLHGSSILERHHLEYSKTLLQDESLNIFQNLNKRQFET
VIHLFEVAIIATDLALYFKKRTMFQKIVDACEQMQTEEEAIKYVTVDPTKKEIIMAMMMT
ACDLSAITKPWEVQSQVALMVANEFWEQGDLERTVLQQQPIPMMDRNKRDELPKLQVGFI
DFVCTFVYKEFSRFHKEITPMLSGLQNNRVEWKSLADEYDAKMKVIEEEAKKQEGGAEKA
AEDSGGGDDKKSKTCLML
Download sequence
Identical sequences G1RQW6
XP_003255282.1.23891 ENSNLEP00000015630 ENSNLEP00000015630

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]