SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for G1RQY2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  G1RQY2
Domain Number - Region: 362-409
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000778
Family Laminin-type module 0.016
Further Details:      
 
Domain Number - Region: 796-829
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000778
Family EGF-type module 0.03
Further Details:      
 
Domain Number - Region: 275-320
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00471
Family EGF-type module 0.056
Further Details:      
 
Domain Number - Region: 608-737
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00816
Family Growth factor receptor domain 0.006
Further Details:      
 
Domain Number - Region: 749-798
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0234
Family EGF-type module 0.085
Further Details:      
 
Domain Number - Region: 142-191
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0314
Family Laminin-type module 0.061
Further Details:      
 
Domain Number - Region: 189-234
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0503
Family EGF-type module 0.082
Further Details:      
 
Domain Number - Region: 230-259
Classification Level Classification E-value
Superfamily EGF/Laminin 0.067
Family Laminin-type module 0.038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) G1RQY2
Sequence length 1044
Comment (tr|G1RQY2|G1RQY2_NOMLE) Multiple EGF like domains 11 {ECO:0000313|Ensembl:ENSNLEP00000015646} KW=Complete proteome; Reference proteome OX=61853 OS=leucogenys). GN=MEGF11 OC=Catarrhini; Hylobatidae; Nomascus.
Sequence
MALSLTGLIAFSFLQATLALNPEDPNVCSHWESYAVTVQESYAHPFDQIYYTRCTDILNW
FKCTRHRISYKTAYRRGLRTMYRRRSQCCPGYYENGDFCIPLCTEECVHGRCVSPDTCHC
EPGWGGPDCSSGCDSDHWGPHCSNRCQCQNGALCNPITGACVCAAGFRGWRCEELCAPGT
HGKGCQLPCQCQHGASCDPRTGECLCAPGYTGVYCEELCPPGSHGAHCELRCPCQNGGTC
HHITGECACPPGWTGVVCAQPCPPGTFGQNCSQDCPCHHGGQCDHVTGQCHCTAGYMGDR
CQEECPFGTFGFQCSQRCDCHNGGQCSPTTGACECQPGYKGPRCQERLCPEGLHGPGCTL
PCPCDADNTISCHPVTGACTCQPGWSGHHCNESCPVGYYGDGCQLPCTCQNGADCHSITG
GCTCAPGFMGEVCAVSCAAGTYGPNCSSICSCNNGGTCSPVDGSCTCKEGWQGLDCTLPC
PSGTWGLNCNESCTCANAAACSPIDGSCSCTPGWLGDTCELPCPDGTFGLNCSEHCDCSH
ADGCDPVTGHCCCLAGWTGIHCDSTCPPGRWGPNCSVSCSCENGGSCSPEDGSCECAPGF
RGPLCQRICPPGFYGHGCAQPCPLCVHSSGPCHHISGICECLPGFSGALCNQVCAGGHFG
QDCAQLCSCANNGTCSPIDGSCQCFPGWIGKDCSQACPPGFWGPACFHACSCHNGASCST
EDGACHCTPGWTGLFCTQRCPAAFFGKDCGRVCQCQNGASCDHISGKCTCRTGFTGQHCE
QRCAPGTFGYGCQQLCECMNNSTCDHVTGTCYCSPGFKGIRCDQAALMMEELNPYTKISP
ALSAERHSVGAVTGIMLLLFLIVVLLGLFAWHRRRQKEKGRDLAPRVSYTPAMRMTSTDY
SLSGACGMDRRQNTYIMDKGFKDYMKESVCSSSTCSLNSSENPYATIKDPPILTCKLPES
SYVEMKSPVHMGSPYTDVPSLSTSNKNIYEVEPTVSVVQEGCGHNSSYIQNAYDLPRNSH
IPGHYDLLPVRQSPANGPSQDKQS
Download sequence
Identical sequences G1RQY2
XP_003267161.1.23891 XP_012362720.1.23891 ENSNLEP00000015646 ENSNLEP00000015646

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]