SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G1RRN3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G1RRN3
Domain Number 1 Region: 449-591
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.08e-21
Family MAM domain 0.00097
Further Details:      
 
Domain Number 2 Region: 186-285
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000377
Family Growth factor receptor domain 0.022
Further Details:      
 
Domain Number 3 Region: 116-155
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000168
Family EGF-type module 0.0054
Further Details:      
 
Weak hits

Sequence:  G1RRN3
Domain Number - Region: 53-92
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0128
Family EGF-type module 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) G1RRN3
Sequence length 595
Comment (tr|G1RRN3|G1RRN3_NOMLE) Nephronectin {ECO:0000313|Ensembl:ENSNLEP00000015898} KW=Complete proteome; Reference proteome OX=61853 OS=leucogenys). GN=NPNT OC=Catarrhini; Hylobatidae; Nomascus.
Sequence
MDFLLALVLVSSLYLQAAAEFDGRWPRQIMSSIGLCRYGGRIDCCWGWARQSWGQCQPVC
QPRCKHGECIGPNKCKCHPGYAGKTCNQDKHIPAPLDQGSEQPLFQPLDHQATSLPSRDL
NECGLKPRPCKHRCMNTYGSYKCYCLNGYMLMPDGSCSSALTCSMANCQYGCDVVKGQIR
CQCPSPGLQLAPDGRTCVDVDECATGRASCPRFRQCANTFGSYICKCHKGFDLMYIGGKY
QCHDVDECSLGQYQCSSFARCYNIHGSYKCKCKEGYQGDGLTCVYIPKVMIEPSGPIHVP
KGNGTILKGDGGHNNWIPDVRSTWWPPKTPYIPPIITNRPTSKPTTRPTPKPIPIPTPPP
PPPLPTELRTPLPPTTPERPTTRLTTIAPAASTPPGGITVDNRVQTDPQKPRGDVFIPRQ
PSNDLFEIFEIERGVSADDEAKDDPGVLVHSCNFDHGLCGWIREKDNDLHWEPIRDPAGG
QYLTVSAAKAPGEKAARLVLPLGRLMHSGDLCLSFRHKVTGLHSGTLQVFVRKHGAQGAA
LWGRNGGHGWRQTQITLRGADIKSVIFKGEKRRGHTGEIGLDDVSLRKGHCSEER
Download sequence
Identical sequences G1RRN3
ENSNLEP00000015898 ENSNLEP00000015898 XP_003257502.1.23891

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]