SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G1RRU2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G1RRU2
Domain Number 1 Region: 79-217
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 2.49e-29
Family DBL homology domain (DH-domain) 0.00054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) G1RRU2
Sequence length 219
Comment (tr|G1RRU2|G1RRU2_NOMLE) Uncharacterized protein {ECO:0000313|Ensembl:ENSNLEP00000015960} KW=Complete proteome; Reference proteome OX=61853 OS=leucogenys). GN= OC=Catarrhini; Hylobatidae; Nomascus.
Sequence
MEPKEATGKENMVTKKKNLAFLRSRLYMLERRKTDTVVESSVSGDHSGTLRRSQSDRTEY
NQKLQEKMTPQSECSVAETLTPEEEHQMKRMMAKREKIIKELIQTEKDYLNDLELCLREV
VQPLRNKKIDRLDVDSLFSNIESVHQISAKLLSLLEEATTDVEPAMQVIGEVFLQIKGPL
EDIYKIYCYHHDEAHSILESYEKEEELKEHLSHCIQSLK
Download sequence
Identical sequences G1RRU2
ENSNLEP00000015960 ENSNLEP00000015960

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]