SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G1RSM4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G1RSM4
Domain Number 1 Region: 42-253
Classification Level Classification E-value
Superfamily p53-like transcription factors 6.53e-83
Family Rel/Dorsal transcription factors, DNA-binding domain 0.00000000171
Further Details:      
 
Domain Number 2 Region: 543-761
Classification Level Classification E-value
Superfamily Ankyrin repeat 3.62e-59
Family Ankyrin repeat 0.0000201
Further Details:      
 
Domain Number 3 Region: 249-381
Classification Level Classification E-value
Superfamily E set domains 3.27e-47
Family NF-kappa-B/REL/DORSAL transcription factors, C-terminal domain 0.00000112
Further Details:      
 
Domain Number 4 Region: 809-890
Classification Level Classification E-value
Superfamily DEATH domain 8.24e-16
Family DEATH domain, DD 0.0044
Further Details:      
 
Weak hits

Sequence:  G1RSM4
Domain Number - Region: 875-923
Classification Level Classification E-value
Superfamily DNA polymerase beta, N-terminal domain-like 0.000719
Family DNA polymerase beta, N-terminal domain-like 0.0057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) G1RSM4
Sequence length 969
Comment (tr|G1RSM4|G1RSM4_NOMLE) Nuclear factor kappa B subunit 1 {ECO:0000313|Ensembl:ENSNLEP00000016247} KW=Complete proteome; Reference proteome OX=61853 OS=leucogenys). GN=NFKB1 OC=Catarrhini; Hylobatidae; Nomascus.
Sequence
MAEDDPYLGRPEQMFHLDPSLTHTIFNPEVFQPQMALPTADGPYLQILEQPKQRGFRFRY
VCEGPSHGGLPGASSEKNKKSYPQVKICNYVGPAKVIVQLVTNGKNIHLHAHSLVGKHCE
DGICTVTAGPKDMVVGFANLGILHVTKKKVFETLEARMTEACIRGYNPGLLVHPDLAYLQ
AEGGGDRQLGDREKELIRQAALQQTKEMDLSVVRLMFTAFLPDSTGSFTRRLEPVVSDAI
YDSKAPNASNLKIVRMDRTAGCVTGGEEIYLLCDKVQKDDIQIRFYEEEENGGVWEGFGD
FSPTDVHRQFAIVFKTPKYKDVNITKPASVFVQLRRKSDLETSEPKPFLYYPEIKDKEEV
QRKRQKLMPNFSDSFGGGSGAGAGGGGMFGSGGGGGGTGSTGPGYSFPHYGFPTYGGITF
HPGTTKSNAGMKHGTMDTESKKDPEGYDKSDDKNTVNLFGKVIETTEQDQEPSEATDGNG
EVTLMYATGTKEESAGVQDNLFLEKAMQLAKRHANALFDYAVTGDVKMLLAVQRHLTAVQ
DENGDGVLHLAIIHLHSQLVRDLLEVTSGLISDDIINMRNDLYQTPLHLAVITKQEDVVE
DLLRAGADLSLLDRLGNSVLHLAAKEGHDKVLSILLKHKKAALLLDHPNGDGLNAIHLAM
MSNSLPCLLLLVAAGADVNAQEQKSGRTALHLAVEHDNISLAGCLLLEGDAHVDSTTYDG
TTPLHIAAGRGSTRLAALLKAAGADPLVENFEPLYDLDDSWENAGEDEGVVPGTTPLDMA
TSWQVFDILNGKPYEPEFTSDDLLAQGDMKQLAEDVKLQLYKLLEIPDPDKNWATLAQKL
GLGILNNAFRLSPAPSKTLMDNYEVSGGTVRELVEALRQMGYTEAIDVIQAASSPVKTTS
QAHSLPLLPASTRQQIDELRDSDSVCDSGVETSFRKLSFTESLTSGGSLLTLNKIPHDYG
QEGPLEGKI
Download sequence
Identical sequences G1RSM4
ENSNLEP00000016247 ENSNLEP00000016247 XP_003257527.1.23891

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]