SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G1RVV6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G1RVV6
Domain Number 1 Region: 431-469
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000119
Family EGF-type module 0.014
Further Details:      
 
Domain Number 2 Region: 316-360
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000017
Family EGF-type module 0.0095
Further Details:      
 
Domain Number 3 Region: 355-397
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000365
Family EGF-type module 0.01
Further Details:      
 
Domain Number 4 Region: 278-312
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000017
Family EGF-type module 0.0086
Further Details:      
 
Domain Number 5 Region: 389-429
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000032
Family EGF-type module 0.0077
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) G1RVV6
Sequence length 588
Comment (tr|G1RVV6|G1RVV6_NOMLE) Delta like canonical Notch ligand 3 {ECO:0000313|Ensembl:ENSNLEP00000017383} KW=Complete proteome; Reference proteome OX=61853 OS=leucogenys). GN=DLL3 OC=Catarrhini; Hylobatidae; Nomascus.
Sequence
MVSPRMSRLLSQTVILALIFLPQARPAGVFELQIHSFGPGPGPGAPRSPCSARGPCRLFF
RVCLKPGLSEEAAESPSPCALGAALSARGPVYTEQPGAPAPDLPLPDGLLQVPFRDAWPG
TFSLIIETWREELGDQIGGPAWSLLARVAGRRRLAAGGPWARDIQRAAWELRFSYRARCE
PPAVGTACTRLCRPHSAPSRCSPGLRPCAPLEDECEAPPVCRAGCSPEYGFCEQPGECRC
LEGWTGPLCTVPVSTSSCLSPRGPSSATTGCLVPGPGPCDGNPCANGGSCSETPGSFECA
CPRGFYGLRCEVSGVTCADGPCFNGGLCVGGADPDSAYICHCPPGFQGSNCEKRVDRCSL
RPCRNGGLCLDLGHALRCRCRAGFAGPRCEHDLDDCAGRACANGGTCVEGGGAHRCSCAL
GFGGRDCRERADPCASRPCAHGGRCYAHFSGLVCACAPGYMGARCEFPVHPDGASALPAA
PSGLRPGDPQRYLLPPALGLLVAAGVAGAALLLVHVRRRGHAQDAGSRLLAGTPEPSVHA
LPDALNNLRTQEGPGDGPSPSVDWNRPEDVDPRGIYVISAPSIFAREA
Download sequence
Identical sequences G1RVV6
ENSNLEP00000017383 ENSNLEP00000017383

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]