SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G1RXL8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G1RXL8
Domain Number 1 Region: 495-720
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 4.66e-60
Family Eukaryotic proteases 0.00000000286
Further Details:      
 
Domain Number 2 Region: 115-208
Classification Level Classification E-value
Superfamily Kringle-like 5.56e-36
Family Kringle modules 0.00000541
Further Details:      
 
Domain Number 3 Region: 210-293
Classification Level Classification E-value
Superfamily Kringle-like 3.14e-34
Family Kringle modules 0.00017
Further Details:      
 
Domain Number 4 Region: 302-386
Classification Level Classification E-value
Superfamily Kringle-like 1.38e-31
Family Kringle modules 0.00016
Further Details:      
 
Domain Number 5 Region: 381-477
Classification Level Classification E-value
Superfamily Kringle-like 1.55e-28
Family Kringle modules 0.0004
Further Details:      
 
Domain Number 6 Region: 36-125
Classification Level Classification E-value
Superfamily Hairpin loop containing domain-like 2.35e-23
Family Hairpin loop containing domain 0.00000363
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) G1RXL8
Sequence length 728
Comment (tr|G1RXL8|G1RXL8_NOMLE) Scatter factor {ECO:0000256|PIRNR:PIRNR001152} KW=Complete proteome; Reference proteome OX=61853 OS=leucogenys). GN=HGF OC=Catarrhini; Hylobatidae; Nomascus.
Sequence
MWVTKLLPALLLQHVLLHLLLLPIAIPYAEGQKKRRNTIHEFKKSAKTTLIKIDPALKIK
TKKVNTADQCANRCTRNKGLPFTCKAFVFDKARKQCLWFPFNSMSSGVKKEFGHEFDLYE
NKDYIRNCIIGKGRSYKGTVSITKSGIKCQPWSSMIPHEHSFLPSSYRGKDLQENYCRNP
RGEEGGPWCFTSNPEVRYEVCDIPQCSEVECMTCNGESYRGLMDHTESGKICQRWDHQTP
HRHKFLPERYPDKGFDDNYCRNPDGQPRPWCYTLDPHTRWEYCAIKTCADNTMNDTDVPL
ETTECIQGQGEGYRGTVNTIWNGIPCQRWDSQYPHKHDMTPENFKCKDLRENYCRNPDGS
ESPWCFTTDPNIRVGYCSQIPNCDMSHGQDCYRGNGKNYMGNLSQTRSGLTCSMWDKNME
DLHRHIFWEPDASKLNENYCRNPDDDAHGPWCYTGNPLIPWDYCPISRCEGDTTPTIVNL
DHPVISCAKTKQLRVVNGIPTRTNVGWMVSLRYRNKHICGGSLIKESWVLTARQCFPSRD
LKDYEAWLGIHDVHGRGDEKRKQVLNISQLVYGPEGSDLVLMKLARPAVLDDFVSTIDLP
NYGCTIPEKTSCSVYGWGYTGLINYDGLLRVAHLYIMGNEKCSQHHRGKVTLNESEICAG
AEKIGSGPCEGDYGGPLVCEQHKMRMVLGVIVPGRGCAIPNRPGIFVRVAYYAKWIHKII
LTYKVPQS
Download sequence
Identical sequences G1RXL8
ENSNLEP00000017995 ENSNLEP00000017995 XP_003252267.1.23891

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]