SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G1RY17 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G1RY17
Domain Number 1 Region: 669-876
Classification Level Classification E-value
Superfamily Mannose 6-phosphate receptor domain 0.0000000000000693
Family Mannose 6-phosphate receptor domain 0.0063
Further Details:      
 
Domain Number 2 Region: 600-675
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000126
Family Growth factor receptor domain 0.0056
Further Details:      
 
Domain Number 3 Region: 285-431
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000314
Family Growth factor receptor domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) G1RY17
Sequence length 1029
Comment (tr|G1RY17|G1RY17_NOMLE) KIAA1324 like {ECO:0000313|Ensembl:ENSNLEP00000018144} KW=Complete proteome; Reference proteome OX=61853 OS=leucogenys). GN=KIAA1324L OC=Catarrhini; Hylobatidae; Nomascus.
Sequence
MFFRARGPVRGRGRGRPAEAPRRGRSPPWSPAWICCWALAGCQAAWAGDLPSTSSHPLPP
CQEKDYHFEYTECDSSGSRWRVAIPNSAVDCSGLPDPVRGKECTFSCASGEYLEMKNQVC
SKCGEGTYSLGSGIKFDEWDELPAGFSNIATFMDTVVGPSDSRPDGCNNSSWIPRGNYIE
SNRDDCTVSLIYAVHLKKSGYVFFEYQYVDNNIFFEFFIQNDQCQEMDTTTDKWVKLTDN
GEWGSHSVMLKSGTNILYWRTTGILMGSKAVKPVLVKNITIEGVAYTSECFPCKPGTFSN
KPGSFNCQVCPRNTYSEKGAKECIRCKDDSQFSEEGSSECTERPPCTTKDYFQIHTPCDE
EGKTQIMYKWIEPKICREDLTDAIRLPPSGEKKDCPPCNPGFYNNGSSSCHPCPPGTFSD
GTKECRPCPAGTEPALGFEYKWWNVLPGNMKTSCFNVGNSKCDGMNGWEVAGDHIQSGAG
GSDNDYLILNLHIPGFKPPTSMTGATGSELGRITFVFETLCSADCVLYFMVDINRKSTNV
VESWGGTKEKQAYTHIIFKNATFTFTWAFQRTNQGQDNRRFINDMVKIYSITATNAVDGV
ASSCRACALGSEQSGSSCVPCPPGHYIEKETNQCKECPPDTYLSIHQVYGKEACIPCGPG
SKNNQDHSVCYSDCFFYHEKENQSLHYDFSNLSSMGSLMNGPSFTSKGTKYFHFFNISLC
GHEGKKMALCTNNITDFTVKEIVAGSDDYTNLVGAFVCQSTIIPSESKGFRAALSSQSII
LADTFLGVTVETTLQNINIKEDMFPVPASQIPDVHFFYKSSTATTSCINGRSTAVKMRCN
PTKSGAGVISVPSKCPAGTCDGCTFYFLWESAEACPLCTEHDFHEIEGACKRGFQETLYV
WNEPKWCIKGISLPEKKLATCETVDFWLKVGAGVGAFTAVLLVALTCYFWKKNQKLEYKY
SKLVMTTNSKECELPAADSCAIMEGEDNEEEVVYSNKQSLLGKLKSLATKEKEDHFESVQ
LKTSRSPNI
Download sequence
Identical sequences G1RY17
XP_012365685.1.23891 ENSNLEP00000018144 ENSNLEP00000018143

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]