SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G1RYR2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G1RYR2
Domain Number 1 Region: 83-266
Classification Level Classification E-value
Superfamily RNI-like 1.06e-33
Family Cyclin A/CDK2-associated p19, Skp2 0.013
Further Details:      
 
Domain Number 2 Region: 18-56
Classification Level Classification E-value
Superfamily F-box domain 0.00000563
Family F-box domain 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) G1RYR2
Sequence length 300
Comment (tr|G1RYR2|G1RYR2_NOMLE) F-box and leucine rich repeat protein 15 {ECO:0000313|Ensembl:ENSNLEP00000018389} KW=Complete proteome; Reference proteome OX=61853 OS=leucogenys). GN=FBXL15 OC=Catarrhini; Hylobatidae; Nomascus.
Sequence
MEPPMEPSGGEQEPGAVRLLDLPWEDVLLPHVLNRVPLRQLLRLQRVSRAFRALVQLHLA
GLRRFDAAQVGPQIPRAALARLLRDAEGLQELALAPCHEWLSDEDLVPVLARNPQLRSVA
LGGCGQLSRRALGALAEGCPRLQRLSLAHCDWVDGLALRGLADRCPALEELDLTACRQLK
DEAIVYLAQRRGAGLRSLSLAVNANVGDAAVQELARNCPELQHLDLTGCLRVGSDGVRTL
AEYCPALRSLRVRHCHHVAESSLSRLRKRGVDIDVEPPLHQALVLLQDMAGFAPFVNLQV
Download sequence
Identical sequences G1RYR2
ENSNLEP00000018389 ENSNLEP00000018389 XP_003255443.1.23891

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]