SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G1RYR7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G1RYR7
Domain Number 1 Region: 678-943
Classification Level Classification E-value
Superfamily RNI-like 5.97e-61
Family 28-residue LRR 0.0024
Further Details:      
 
Domain Number 2 Region: 17-93
Classification Level Classification E-value
Superfamily DEATH domain 2.26e-18
Family Caspase recruitment domain, CARD 0.0081
Further Details:      
 
Weak hits

Sequence:  G1RYR7
Domain Number - Region: 190-292
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.000879
Family G proteins 0.068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) G1RYR7
Sequence length 953
Comment (tr|G1RYR7|G1RYR7_NOMLE) Nucleotide binding oligomerization domain containing 1 {ECO:0000313|Ensembl:ENSNLEP00000018394} KW=Complete proteome; Reference proteome OX=61853 OS=leucogenys). GN=NOD1 OC=Catarrhini; Hylobatidae; Nomascus.
Sequence
MEEQGYSEMEIIPSESHPHIQLLKSNRELLVTHIRNTQCLVDNLLKNDYFSAEDAEIVCA
CPTQPDKVRKILDLVQSKGEEVSEFFLYLLQQLADAYVDLRPWLLEIGFSPSLLTQSKVV
VNTDPVSRYSQQLRHHLGSDSKFVLCYAQKEELLLEEIYMDSIMELVGFSNESLGSLDSL
ACLLDHTTGILNEQGETIFILGDAGVGKSMLLQRLQSLWATGRLDAGVKFFFHFRCRMFS
CFKQSDRLCLQDLLFKHYCYPERDPEEVFAFLLRFPHVALFTFDGLDELHSDLDLSRVPD
SSCPWEPAHPLVLLANLLSGKLLKGASKLLTARTGVEIPCQFLRKKVLLRGFSPSHLRAY
ARRMFPQRALQDRLLSQLEANPNLCSLCSVPLFCWIIFRCFQHFCAAFEGSPQLPDCTMT
LTDVFLLVTEVHLNRMQPSSLVQRNTRSPVETLRAGRDTLCSLGQVAHRGMEKSLFVFTQ
EEVQASGLQEGDMQLGFLRALPELGPGRDQQSYEFFHLTLQAFFTALFLVLDDRVGTQEL
LRFFQEWMPPGGAATASCYPPFLPFQCLRGSVLAREDLFKNKDHFQFTNLFLCGLLSKAK
QKLLRHLVPAAALRRKRKALWAHLFSSLRGYLKSLPRVQVESFNQVQAMPTFLWMLRCIY
ETQSQKVGQLAARGICANYLKLTYCNACSADCSALSFVLYHFSKRLALDLDNNNLNDYGV
RELRPCFSRLTVLRLSVNQITDGGVKVLSEELTKYKIVTYLGLYNNQITDVGARYVTKIL
DECKGLTHLKLGKNKITSEGGKCLALAVKNSKSISDVGMWGNQVGDEGAKAFAEALRNHP
SLTTLSLASNGVSTEGGKSLARALQQNTSLEILWLTQNELNDEVAESLAEMLKVNQTLKH
LWLIQNQITAKGTAQLADALQSNTGITEICLNGNLIKPEEAKVYEDEKRIICF
Download sequence
Identical sequences G1RYR7
ENSNLEP00000018394 ENSNLEP00000023706 ENSNLEP00000018394 XP_003270528.1.23891 XP_012352432.1.23891

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]