SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G1RYT1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G1RYT1
Domain Number 1 Region: 3-241
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 2.27e-52
Family FAD/NAD-linked reductases, N-terminal and central domains 0.0025
Further Details:      
 
Domain Number 2 Region: 312-485
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 0.000000000000138
Family FAD/NAD-linked reductases, N-terminal and central domains 0.0091
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) G1RYT1
Sequence length 535
Comment (tr|G1RYT1|G1RYT1_NOMLE) Flavin-containing monooxygenase {ECO:0000256|RuleBase:RU361177} KW=Complete proteome; Reference proteome OX=61853 OS=leucogenys). GN=FMO2 OC=Catarrhini; Hylobatidae; Nomascus.
Sequence
MAKKVAVIGAGVSGLISLKCCVDEGLEPTCFERTEDIGGVWRFKENVEDGRASIYQSVVT
NTSKEMSCFSDFPMPEDFPNFLHNSKLLEYFRIFVKKFDLLKYIQFQTTVLSVRKCPDFS
SSSQWKVVTQSNGKEQSAVFDAVMVCSGHHILPHIPLKSFPGIEKFKGQYFHSRQYKHPD
GFEGKRILVIGMGNSGSDIAVELSKNAAQVFISTRHGTWVMSRISEDGYPWDSVFHTRFR
SMLRNVLPRTAVKWMIEQQMNRWFNHENYGLEPQNKYIMKEPVLNDDVPSRLLCGAITVK
STVKELTETSAIFEDGTVEENIDVIIFATGYSFSFPFLEDSLVKVENNMVSLYKYIFPAH
LEKSTLACIGLIQPLGSIFPTAELQARWVTRVFKGLCSLPSKRTMMMDIIKRNEKRIDLF
GESQSQTLQINYVDYLDELALEIGAKPEFCSLLFKDPKLAVRLYFGPCNSYQYRLVGPGQ
WEGARSAIFTQKQRILKPLKTRALKDSSNFSVSFLLKILGLLAVVVAFFCQLQWS
Download sequence
Identical sequences G1RYT1
ENSNLEP00000018408 XP_003258916.1.23891 ENSNLEP00000018408

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]