SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G1RZF4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G1RZF4
Domain Number 1 Region: 29-202
Classification Level Classification E-value
Superfamily MHC antigen-recognition domain 1.71e-52
Family MHC antigen-recognition domain 0.0000136
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) G1RZF4
Sequence length 263
Comment (tr|G1RZF4|G1RZF4_NOMLE) Uncharacterized protein {ECO:0000313|Ensembl:ENSNLEP00000018631} KW=Complete proteome; Reference proteome OX=61853 OS=leucogenys). GN=RAET1E OC=Catarrhini; Hylobatidae; Nomascus.
Sequence
MRRMSLTSSPVCLFLLLLLQLIALEIMVGAHSLCFNFTIKSWSRPGQPWCEAQVFMNKIL
FLQYDSDNNMVKPLGLLGKKVNATSTRGELTQTLGEVGRDLRMLLLDIKPQTKTSGPSTL
QVEMFCQREAEQCTGASWQFAINGEKSLLFDAMNMTWTVINHEASKIKETWKKDRGLEKY
FRKLSKGDCDQWLSEFLGHWEAMPEPTVSPVNASDIHWSSSSLPDTWIILGAFILLVLMG
IVVIYVRWQNGEWQAGLWPLRTS
Download sequence
Identical sequences G1RZF4
ENSNLEP00000018631 ENSNLEP00000018631 XP_003255919.1.23891

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]