SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G1RZY0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G1RZY0
Domain Number 1 Region: 118-417
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 4.35e-102
Family Higher-molecular-weight phosphotyrosine protein phosphatases 0.00000158
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) G1RZY0
Sequence length 420
Comment (tr|G1RZY0|G1RZY0_NOMLE) Protein tyrosine phosphatase, non-receptor type 20 {ECO:0000313|Ensembl:ENSNLEP00000018808} KW=Complete proteome; Reference proteome OX=61853 OS=leucogenys). GN=PTPN20 OC=Catarrhini; Hylobatidae; Nomascus.
Sequence
MSSPRDFRAESAKDYEGNDSEAEDLNFRETVPSSSQKNTPRSKVFENKVNSEKVKLCLRN
FPHNDYEDVFEEPSESGSDPSVWTARGPFRRDRWSSEDEEPAGPSQALSPLLSDTHKIVS
EGELDQLAQIQPLIFNFHEQTAIKDCLKMLEKKTAAYDIMQEFMALELKNLPGEFNSGNQ
PSNREKNRYRDILPYDSTRVPLGKSKDYINASYIRIVNCGEEYFYIATQGPLLSTIDDFW
QMVLENNSNVIAMITREIESGIIKCYHYWPISPKKPLELKHFRVFLENYQILQYFIIRMF
QVVEKSTGTSHSVKQLQFTKWPDHGTPASADSFIKYIRYARKSHLTGPMVVHCSAGIGRT
GVFLCVDVVFCAIVKNCSFNIMDIVAQMREQRSGMVQTKEQYHFCYDIVLEVLRKLLTLD
Download sequence
Identical sequences G1RZY0
XP_012359045.1.23891 ENSNLEP00000018808 ENSNLEP00000018808

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]