SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G1S1P0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  G1S1P0
Domain Number - Region: 36-89
Classification Level Classification E-value
Superfamily FnI-like domain 0.00303
Family Fibronectin type I module 0.043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) G1S1P0
Sequence length 114
Comment (tr|G1S1P0|G1S1P0_NOMLE) Prostate secreted seminal plasma protein {ECO:0000256|RuleBase:RU364124} KW=Complete proteome; Reference proteome OX=61853 OS=leucogenys). GN=MSMB OC=Catarrhini; Hylobatidae; Nomascus.
Sequence
MNVLVGSLVIFTTFVTLCNASCYFIPNERVAGDSTRECMDLEGNKHPINSEWQTDNCETC
TCYETEISCCTLVSTPVGYDKDNCQRIFKKEDCKYIVVEKKDPKKTCSVSEWII
Download sequence
Identical sequences G1S1P0
ENSNLEP00000019428 ENSNLEP00000019428 XP_003278237.1.23891

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]