SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G1S3V9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G1S3V9
Domain Number 1 Region: 644-707
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000729
Family Complement control module/SCR domain 0.0018
Further Details:      
 
Domain Number 2 Region: 564-612
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000129
Family TSP-1 type 1 repeat 0.00068
Further Details:      
 
Domain Number 3 Region: 24-78
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000811
Family TSP-1 type 1 repeat 0.0032
Further Details:      
 
Domain Number 4 Region: 141-173
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000183
Family LDL receptor-like module 0.0015
Further Details:      
 
Domain Number 5 Region: 699-754
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000499
Family Complement control module/SCR domain 0.0028
Further Details:      
 
Domain Number 6 Region: 80-128
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000575
Family TSP-1 type 1 repeat 0.0038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) G1S3V9
Sequence length 934
Comment (tr|G1S3V9|G1S3V9_NOMLE) Complement C6 {ECO:0000313|Ensembl:ENSNLEP00000020197} KW=Complete proteome; Reference proteome OX=61853 OS=leucogenys). GN=C6 OC=Catarrhini; Hylobatidae; Nomascus.
Sequence
MARRSVLYFILLSALINKGQACFCDHYPWTQWSSCSKTCNSGTQSRHRQIVVDKYYQENF
CEQICSKQETRECNWQRCPINCLLGDFGPWSDCDPCVEKQSKVRSVLRPSQFGGQPCTEP
LVAFQPCIPSKLCKIEEADCKNKFRCDSGRCIATKLECNGENDCGDNSDERDCGRTKAVC
ARKYNPIPSVQLMGNGFHLLAGEPRGEVLDNSFTGGICKTVKSSRTSNPYRVPANLENVS
FEVQTAEDDLKTDFYKDLTSLGHSENQHGSYSSQDGSSFSVPIFYSSKRSENINHNSAFK
QAIQASHKKDSSFIRIHKVMKVLNFTTKAKDLHPSDVFLKALNHLPLEYNSALYSRIFDD
FGTHYFTSGSLGGMYDLLYQFSSEELKNSGLTEEEAKHCVRIETKKRVLFVKKTKVEHRC
TTNKLSEKHEGSFIQGAEKSISLIRGGRSEYAAALAWEKGSSGLEEKTFSEWLESVKENP
AVIDFELAPITDLVRNIPCAVTKRNNLRKAFQEYAAKFDPCQCAPCPNNGRPTLSGTECL
CVCQSGTYGENCERRSPDYKSNAVDGHWGCWSSWSTCDATYKRSRTRECNNPAPQQGGKR
CEGEKRQEEDCTFSIMENNGQPCINDDEEMKEVDLPEMEADSGCPQPVPPENGFIRNEKK
LYSVGEDVEISCLTGFETVGYQYFRCLPDGTWRQGDVECQRTECIKPVVQEVLTITPFQR
LYRIGESIELTCPKGFVIAGPSRYTCQGNSWTPPISNSLTCEKDTLTKLKGHCQPGQKQS
GSGCICMSPEEDCSHYSEDLCVFDTDSNDYFTSPACKFLAEKCLNNQQLHFLHIGSCQDG
RQLEWGLERTRLSSNSTKKESCGYDTCYDWEKCSASTSKCVCLLPPQCFKGGNQLYCVKM
GSSTSEKTLNICEVGAIRCANRKMEILHPGKCLA
Download sequence
Identical sequences G1S3V9
XP_003274434.1.23891 ENSNLEP00000020197 ENSNLEP00000020197

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]