SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G1S4L5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G1S4L5
Domain Number 1 Region: 37-204
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 2.58e-43
Family Dual specificity phosphatase-like 0.0000411
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) G1S4L5
Sequence length 221
Comment (tr|G1S4L5|G1S4L5_NOMLE) Dual specificity phosphatase and pro isomerase domain containing 1 {ECO:0000313|Ensembl:ENSNLEP00000020453} KW=Complete proteome; Reference proteome OX=61853 OS=leucogenys). GN=DUPD1 OC=Catarrhini; Hylobatidae; Nomascus.
Sequence
MTSGEVKTSLKNAYSSAKRLSPKMEEEGEEEDYCTPGAFELERLFWKGSPQYTHVNEVWP
KLYIGDEATALDRYRLQKAGFTHVLNAAHGRWNVDTGPNYYRDMDIQYHGVEADDLPTFD
LSVFFYPAAAFIDRALRDDHSKILVHCVMGRSRSATLVLAYLMIHKDMTLVDAIQQVAKN
RCVLPNRGFLKQLRELDKQLVQQRRQAQCQDGEEEEDSREL
Download sequence
Identical sequences G1S4L5
XP_003271324.1.23891 ENSNLEP00000020453 ENSNLEP00000020453

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]