SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G1S523 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G1S523
Domain Number 1 Region: 260-317
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.95e-23
Family Classic zinc finger, C2H2 0.0045
Further Details:      
 
Domain Number 2 Region: 428-485
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 9.75e-23
Family Classic zinc finger, C2H2 0.0055
Further Details:      
 
Domain Number 3 Region: 372-429
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.22e-22
Family Classic zinc finger, C2H2 0.0075
Further Details:      
 
Domain Number 4 Region: 596-653
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.34e-22
Family Classic zinc finger, C2H2 0.0068
Further Details:      
 
Domain Number 5 Region: 4-61
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 4.58e-22
Family KRAB domain (Kruppel-associated box) 0.0011
Further Details:      
 
Domain Number 6 Region: 204-261
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.09e-21
Family Classic zinc finger, C2H2 0.006
Further Details:      
 
Domain Number 7 Region: 485-541
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.16e-21
Family Classic zinc finger, C2H2 0.0047
Further Details:      
 
Domain Number 8 Region: 540-597
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.01e-19
Family Classic zinc finger, C2H2 0.0078
Further Details:      
 
Domain Number 9 Region: 149-205
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.88e-17
Family Classic zinc finger, C2H2 0.012
Further Details:      
 
Domain Number 10 Region: 643-694
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.88e-17
Family Classic zinc finger, C2H2 0.0088
Further Details:      
 
Domain Number 11 Region: 302-351
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000000181
Family Classic zinc finger, C2H2 0.0059
Further Details:      
 
Domain Number 12 Region: 94-150
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000000323
Family Classic zinc finger, C2H2 0.0059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) G1S523
Sequence length 695
Comment (tr|G1S523|G1S523_NOMLE) Zinc finger protein 607 {ECO:0000313|Ensembl:ENSNLEP00000020611} KW=Complete proteome; Reference proteome OX=61853 OS=leucogenys). GN=ZNF607 OC=Catarrhini; Hylobatidae; Nomascus.
Sequence
MACGSITFGDVAIDFSHQEWEYLNLVQKTLYQEVMMENYDNLVSLGHSISKPDLITLLEQ
GKEPWMIVREETRGECTDLDSRCEIISDGKMKLYRKHSSVTLHQRIHNGQKPYECKECQK
AFSHLTELMVHQTIHTSEEPDQREEFGKAFSHLTDLREHQKIYAREKPYECEECGKVFSY
PANLAQHGKVHVEKPYECTECGEAFRTSRQLTVHHRFHYGEKPYECKECGKAFSVYGRLS
RHQSIHTGEKPFECNKCGKSFRLKAGLKVHQSIHTGEKPHECKECGKAFRQFSHLVGHKR
IHTGEKPYECKECGKGFTCRYQLTMHQRIYSGEKPYECKENGEAFSSGHQLSAPHTFESV
EKPYKCEECGKAFSVHGRLTRHQGIHSGKKPYECNKCGKSFRLNSSLKIHQNIHTGEKPY
KCKECGKAFSQRAHLAHHNRIHTGYKPFECKECGKSFRCASYLVIHERIHTGEKPYVCQE
CGKGFSYSHKLTIHHRVHTGEKPYECKECGKAFSVSGQLTQHLSIHSGKKPFECNKCGKS
FRFISVLKAHQNIHSAEKPYECKECGKAFRHATSLIYHDQTHAGEKSYECKECGETFSHA
SHLIIHERIHTGDKPYECKRCGKAFRCASYLVRHERIHADGNPYMCEECGKAFNSSHELS
IHHRVHTGEKPFKCNKCRRSFRLRSILEVHQRIHI
Download sequence
Identical sequences G1S523
XP_003252727.2.23891 XP_004089624.1.23891

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]