SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G1S624 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G1S624
Domain Number 1 Region: 65-159
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000793
Family I set domains 0.087
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) G1S624
Sequence length 194
Comment (tr|G1S624|G1S624_NOMLE) Interleukin 18 binding protein {ECO:0000313|Ensembl:ENSNLEP00000020962} KW=Complete proteome; Reference proteome OX=61853 OS=leucogenys). GN=IL18BP OC=Catarrhini; Hylobatidae; Nomascus.
Sequence
MTMRHNWTPDLSPLWVLLLCVHIDTLLVRATPVSQTTTAATASVRSTKDPCPSQPPVFPA
AKQCPALEVTWPEVEVPLNGTLTLSCMACSRFPNFSILYWLGNGSFIEHLPGRLREGRTS
REHGSTGTQLCKALVLEQLTPALHSTNFSCVLVDPGQVVQHHVVLAQLWAGLRTTLPPTQ
EALPSSHSSPQQQG
Download sequence
Identical sequences G1S624
ENSNLEP00000020962 ENSNLEP00000020962 XP_003254823.1.23891

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]