SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G1S724 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G1S724
Domain Number 1 Region: 706-977
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.04e-67
Family Protein kinases, catalytic subunit 0.000000026
Further Details:      
 
Domain Number 2 Region: 322-514
Classification Level Classification E-value
Superfamily L domain-like 3.4e-49
Family L domain 0.000000103
Further Details:      
 
Domain Number 3 Region: 28-204
Classification Level Classification E-value
Superfamily L domain-like 8.22e-46
Family L domain 0.000000175
Further Details:      
 
Domain Number 4 Region: 499-629
Classification Level Classification E-value
Superfamily Growth factor receptor domain 4.32e-22
Family Growth factor receptor domain 0.0000000385
Further Details:      
 
Domain Number 5 Region: 179-332
Classification Level Classification E-value
Superfamily Growth factor receptor domain 2.24e-19
Family Growth factor receptor domain 0.0000000191
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) G1S724
Sequence length 1342
Comment (tr|G1S724|G1S724_NOMLE) Erb-b2 receptor tyrosine kinase 3 {ECO:0000313|Ensembl:ENSNLEP00000021313} KW=Complete proteome; Reference proteome OX=61853 OS=leucogenys). GN=ERBB3 OC=Catarrhini; Hylobatidae; Nomascus.
Sequence
MRANDALQVLGLLFSLARGSEVGNSQAVCPGTLNGLSVTGDAENQYQTLYKLYERCEVVM
GNLEIVLTGHNADLSFLQWIREVTGYVLVAMNEFSTLPLPNLRVVRGTQVYDGKFAIFIM
LNYNTNSSHALRQLRLTQLTEILSGGVYIEKNDKLCHMDTIDWRDIVRDRDAEIVVKDNG
RSCPPCHEVCKGRCWGPGPEDCQTLTKTICAPQCNGHCFGPNPNQCCHDECAGGCSGPQD
TDCFACRHFNDSGACVPRCPQPLVYNKLTFQLEPNPHTKYQYGGVCVASCPHNFVVDQTS
CVRACPPDKMEVDKNGLKMCEPCGGLCPKACEGTGSGSRFQTVDSSNIDGFVNCTKILGN
LDFLITGLNGDPWHKIPALDPEKLSVFRTVREITGYLNIQSWPPHMHNFSVFSNLTTIGG
RSLYNRGFSLLIMKNLNVTSLGFRSLKEISAGRIYISANRQLCYHHSLNWTKVLRGPTEE
RLDIKHNRPRRDCVAEGKVCDPLCSSGGCWGPGPGQCLSCRNYSRGGVCVTHCNFLNGEP
REFAHEAECFSCHPECQPMEGTATCNGSGSDTCAQCAHFRDGPHCVSSCPHGVLGAKGPI
YKYPDVQNECRPCHENCTQGCKGPELQDCLGQTLVLIGKTHLTMALTVIAGLVVIFMMLG
GTFLYWRGRRIQNKRAMRRYLERGESIEPLDPSEKANKVLARIFKETELRKLKVLGLGVF
GTVHKGVWIPEGESIKIPVCIKVIEDKSGRQSFQAVTDHMLAIGSLDHAHIVRLLGLCPG
SSLQLVTQYLPLGSLLDHVRQHRGALGPQLLLNWGVQIAKGMYYLEEHGMVHRNLAARNV
LLKSPSQVQVADFGVADLLPPDDKQLLYSEAKTPIKWMALESIHFGKYTHQSDVWSYGVT
VWELMTFGAEPYAGLRLAEVPDLLEKGERLAQPQICTIDVYMVMVKCWMIDENIRPTFKE
LANEFTRMARDPPRYLVIKRESGPGIAPGPEPHGLTNKKLEEVELEPELDLDLDLEAEDD
NLATTTLGSALSLPVGTLNRPRGSQSLLSPSSGYMPMNQGNLGESCQESAVSGSSERCPR
PVSLHPMPRGCLASESSEGHVTGSEAELQEKVSMCRSRSRSRSPRPHGDSAYHSQRHSLL
TPVTPLSPPGLEEEDVNGYVMPDTHLKGTPSSREGTLSSVGLSSVLGTEEEDEDEEYEYM
NRRRRHSPPHPPRPGSLEELGYEYMDVGSDLSASLGSTQSCPLHPVPIMPTAGTTADEDY
EYMNRQRGGGGPGGDYAAMGACPASEQGYEEMRAFQGPGHQAPHVHYARLKTLRSLEATD
SAFDNPDYWHSRLFPKANAQRT
Download sequence
Identical sequences G1S724
ENSNLEP00000021313 XP_003252875.1.23891 XP_012365819.1.23891 ENSNLEP00000021313

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]