SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G1S884 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G1S884
Domain Number 1 Region: 20-141
Classification Level Classification E-value
Superfamily Lysozyme-like 7.19e-46
Family C-type lysozyme 0.000000319
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) G1S884
Sequence length 142
Comment (tr|G1S884|G1S884_NOMLE) Lysozyme G {ECO:0000313|EMBL:CDM98755.1} KW=Complete proteome; Reference proteome OX=61853 OS=leucogenys). GN=LYZG OC=Catarrhini; Hylobatidae; Nomascus.
Sequence
MRFFVPLFLVGILFPAIPAKQFTKCELSQLLKDIDGYGGIALPELICTIFHTSGYDTQAI
VENSESTEYGLFQISNKLWCKSSQVPQSRNICDISCDKFLDDDITDDIMCAKKILDIKGI
DYWLAHKALCTEKLEQWLCEKL
Download sequence
Identical sequences G1S884
ENSNLEP00000021723 ENSNLEP00000021723 XP_003252260.1.23891

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]