SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G1S8E5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G1S8E5
Domain Number 1 Region: 156-454
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 2.97e-74
Family Protein kinases, catalytic subunit 0.0000593
Further Details:      
 
Domain Number 2 Region: 1-114
Classification Level Classification E-value
Superfamily DEATH domain 1.65e-38
Family DEATH domain, DD 0.00000174
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) G1S8E5
Sequence length 460
Comment (tr|G1S8E5|G1S8E5_NOMLE) Interleukin 1 receptor associated kinase 4 {ECO:0000313|Ensembl:ENSNLEP00000021784} KW=Complete proteome; Reference proteome OX=61853 OS=leucogenys). GN=IRAK4 OC=Catarrhini; Hylobatidae; Nomascus.
Sequence
MNKPITPSTYVRCLNVGLIRKLSDFIDPQEGWKKLAVAIKKPSGDDRYNQFHIRRFEALL
QTGKSPTSELLFDWGTTNCTVGDLVDLLIQNEFFAPASLLLPDAVPKTANTLPSKEAVTV
QQKQMPFYDKDRTLMTPVQYLEQSYMPPDSSSPENKSLEVSDTRFHSFSFYELKNVTNNF
DERPISVGGNKMGEGGFGVVYKGYVNNTTVAVKKLAAMVDITTEELKQQFDQEIKVMAKC
QHENLVELLGFSSDGDDLCLVYVYMPNGSLLDRLSCLDGTPPLSWHMRCKIAQGAANGIN
FLHENHHIHRDIKSANILLDEAFTAKISDFGLARASEKFAQTVMTSRIVGTTAYMAPEAL
RGEITPKSDIYSFGVVLLEIITGLPAVDEHREPQLLLDIKEEIEDEEKTIEDYIDKKMND
ADSTSVEAMYSVASQCLHEKKNKRPDIKKVQQLLQEMTAS
Download sequence
Identical sequences G1S8E5
XP_003252320.1.23891 XP_003252321.1.23891 XP_012366192.1.23891 ENSNLEP00000021784 ENSNLEP00000021784

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]