SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G1S8R3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G1S8R3
Domain Number 1 Region: 35-108
Classification Level Classification E-value
Superfamily RING/U-box 6.83e-18
Family RING finger domain, C3HC4 0.0049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) G1S8R3
Sequence length 336
Comment (tr|G1S8R3|G1S8R3_NOMLE) Ring finger protein 2 {ECO:0000313|Ensembl:ENSNLEP00000021902} KW=Complete proteome; Reference proteome OX=61853 OS=leucogenys). GN=RNF2 OC=Catarrhini; Hylobatidae; Nomascus.
Sequence
MSQAVQTNGTQPLSKTWELSLYELQRTPQEAITDGLEIVVSPRSLHSELMCPICLDMLKN
TMTTKECLHRFCADCIITALRSGNKECPTCRKKLVSKRSLRPDPNFDALISKIYPSRDEY
EAHQERVLARINKHNNQQALSHSIEEGLKIQAMNRLQRGKKQQIENGSGAEDNGDSSHCS
NASTHSNQEAGPSNKRTKTSDDSGLELDNNNAAMAIDPVMDGASEIELVFRPHPTLMEKD
DSAQTRYIKTSGNATVDHLSKYLAVRLALEELRSKGESNQMNLDTASEKQYTIYIATASG
QFTVLNGSFSLELVSEKYWKVNKPMELYYAPTKEHK
Download sequence
Identical sequences A0A096MYZ1 A0A0D9RKA3 A0A2J8V896 A0A2K5JVI4 A0A2K5LVK9 A0A2K5U4W8 A0A2K5ZBW1 A0A2K6ECC7 A0A2K6N6A2 A0A2K6NYK6 G1S8R3 G3REQ3 H2Q0S2 H9FY38 Q99496
gi|6005747|ref|NP_009143.1| HT6296 ENSPTRP00000002962 NP_009143.1.87134 NP_009143.1.92137 XP_003264507.1.23891 XP_003815650.1.60992 XP_004028095.1.27298 XP_005540285.1.63531 XP_005540286.1.63531 XP_007987367.1.81039 XP_007987368.1.81039 XP_008966811.1.60992 XP_009437880.1.37143 XP_010367259.1.97406 XP_011508153.1.92137 XP_011508154.1.92137 XP_011744670.1.29376 XP_011744671.1.29376 XP_011744672.1.29376 XP_011789564.1.43180 XP_011828666.1.47321 XP_011903006.1.92194 XP_011903012.1.92194 XP_014977417.1.72884 XP_015302463.1.63531 XP_017703614.1.44346 XP_514057.3.37143 ENSGGOP00000014044 ENSGGOP00000014044 ENSNLEP00000021902 ENSP00000356480 ENSPTRP00000002962 ENSPANP00000005175 ENSP00000356480 ENSNLEP00000021902 ENSP00000356479 9598.ENSPTRP00000002962 9606.ENSP00000356480

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]