SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G1S8V2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G1S8V2
Domain Number 1 Region: 463-676
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 6.13e-32
Family Laminin G-like module 0.0079
Further Details:      
 
Domain Number 2 Region: 688-889
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.83e-27
Family Laminin G-like module 0.013
Further Details:      
 
Domain Number 3 Region: 911-1113
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 5.34e-25
Family Laminin G-like module 0.011
Further Details:      
 
Domain Number 4 Region: 186-228
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000000589
Family EGF-type module 0.0029
Further Details:      
 
Domain Number 5 Region: 148-191
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000109
Family EGF-type module 0.0037
Further Details:      
 
Domain Number 6 Region: 1297-1337
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000131
Family EGF-type module 0.0047
Further Details:      
 
Domain Number 7 Region: 224-267
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000285
Family EGF-type module 0.0052
Further Details:      
 
Domain Number 8 Region: 1140-1181
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000929
Family EGF-type module 0.0056
Further Details:      
 
Domain Number 9 Region: 304-343
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000211
Family EGF-type module 0.0081
Further Details:      
 
Domain Number 10 Region: 262-300
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000161
Family EGF-type module 0.0044
Further Details:      
 
Domain Number 11 Region: 1214-1251
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000237
Family EGF-type module 0.019
Further Details:      
 
Domain Number 12 Region: 1176-1216
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000026
Family EGF-type module 0.01
Further Details:      
 
Domain Number 13 Region: 72-114
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000286
Family EGF-type module 0.025
Further Details:      
 
Domain Number 14 Region: 111-153
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000511
Family EGF-type module 0.011
Further Details:      
 
Domain Number 15 Region: 1264-1301
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000901
Family EGF-type module 0.027
Further Details:      
 
Domain Number 16 Region: 377-481
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000116
Family Growth factor receptor domain 0.012
Further Details:      
 
Weak hits

Sequence:  G1S8V2
Domain Number - Region: 924-959
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00327
Family EGF-type module 0.022
Further Details:      
 
Domain Number - Region: 27-58
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0117
Family EGF-type module 0.023
Further Details:      
 
Domain Number - Region: 885-915
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0168
Family EGF-type module 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) G1S8V2
Sequence length 1406
Comment (tr|G1S8V2|G1S8V2_NOMLE) Crumbs 1, cell polarity complex component {ECO:0000313|Ensembl:ENSNLEP00000021941} KW=Complete proteome; Reference proteome OX=61853 OS=leucogenys). GN=CRB1 OC=Catarrhini; Hylobatidae; Nomascus.
Sequence
MALKNINYLLIFYLSFSLLIYIKNSFCNKNNTRCLSNSCQNNSTCKDFSKDSDCSCSDTA
NNFDKDCDDMKDPCFSNPCQGSATCVNTPGERSFLCKCPPGYSGTICETTIGSCGENSCQ
HGGICHQDPIDPVCICPAGYAGRFCEIDHDECASSPCQNGAVCQDGIDGYSCFCVPGYQG
RHCDLEVNECASDPCKNEATCLNEIGRYTCICPHDYSGVNCELEIDECWSQPCLNGATCQ
DALGAYFCNCAPGFLGDHCELNIDECASQPCLHGGLCVDGENRYSCNCTGSGFTGTHCEI
LMPLCWSKPCYNNATCEDSVDNYTCHCWPGYTGAQCEIDINECNSNPCQSNGECVELSSE
KQYGHITGLPSSFSYHEASGYVCICQPGFTGIHCEEDVNECSSNPCQNGGTCENLPGNYT
CHCPFDNLSRTFYGGRDCSDILLGCTHQHCLNHGICIPHFQDGQHGFSCLCPSGYTGSLC
EIATTLSFEGNGFLWVKSGSVTTKGSVCNIALRFQTVQPMALLLFRSNRDVFVKLELLSG
YIHLSIQVNNQSKVLLYISHNTSDGEWHFVEVIFAEAVTLTLIDDSCKKKCIAKAPSPLE
SDQSICAFQNSFLGGLPVGTTSNGVALLNFYNIPSTPSFVGCLQDIKIDWNHITLENISS
GSSLNVKAGCVRKDWCESQPCQSRGRCINLWLNYQCDCHRPYKGPNCLREYVAGRFGQDD
STGYVVFTLDESYGDTISLSMFVRTLQPSGLLLALENSTYQYIRVWLEHGRLAMLTPNSP
KLVVKFVLNDGNVHLISLKIKPNKIELYQSSQNLGFISASTWKIQKGDVIYIGGLPDKQD
TELNGGFFKGCIQDVRLNNQNLEFFPNSTNDASLNPVLVNVTQGCPGDNSCKSNPCHNGG
VCHSLWDDFSCSCPAHTSGKACEEVQWCGFSPCPRGAQCQPVLQGFECIANAVFHGQSSQ
TLFRSNGNITRELTNITFGFRTRDANVIILHAEKEPEFLNISIQDSRLFFQLQSGNSFYM
LSLTSLQSVNDGTWHEVTLSMTDPLSQTSRWQMEVDNQTPFVTSTIATGSLNFLKDNTDI
YVGDGAIDNIKGLQGCLSTIEIGGIYLSYFENVHGFTNKPQEEQFLKISTNSVVTGCLQL
NVCNSNPCLHGGNCEDIYSSYHCSCPLGWSGKHCELNIDECFSNPCIHGNCSDRVAAYHC
TCEPGYTGVNCEVDIDNCQSHQCANGATCISDTNGYSCLCFGNFTGKFCRQSRLPSTVCG
NEKTNLTCYNGGNCTEFQAELKCMCRPGFTGERCEKDIDECASDPCVNGGRCQDLLNKFQ
CLCDVAFAGERCEVDLADDLISDIFTAIGSVTLALLLILLLAIVASVVTSNKRATQGTYS
PSRQEKEGSRVEMWNLMPPPAMERLI
Download sequence
Identical sequences G1S8V2
ENSNLEP00000021941 XP_012357400.1.23891 ENSNLEP00000021941

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]