SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G1S9L0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G1S9L0
Domain Number 1 Region: 92-162
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000221
Family V set domains (antibody variable domain-like) 0.03
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) G1S9L0
Sequence length 255
Comment (tr|G1S9L0|G1S9L0_NOMLE) Transmembrane protein 81 {ECO:0000313|Ensembl:ENSNLEP00000022201} KW=Complete proteome; Reference proteome OX=61853 OS=leucogenys). GN=TMEM81 OC=Catarrhini; Hylobatidae; Nomascus.
Sequence
MKVLATSFVLGSLGLAFYLPLVVTTPKTLAIPEKLQEAVGKVIINATTCTVTCGLGYKEE
TVCEVGPDGVRRKCQTQRLECLTNWICGMLHFTILIGKEFELSCLSSDILEIGQEAFRFT
WRLARGIISTDDEVFKPFRANSHFVKFKYAQEYDSGTYRCDVQLLKNLRLVKRLYFGLRV
LPPNLVNLNFHQSLTEDQKLIDEGLEVNLDSYSKPHHPKWKKKVASALGIGIASGVVGGV
LVRIVLCVLRGGLQQ
Download sequence
Identical sequences G1S9L0
XP_003273211.1.23891 ENSNLEP00000022201 ENSNLEP00000022201

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]