SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G1SAL3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G1SAL3
Domain Number 1 Region: 32-175
Classification Level Classification E-value
Superfamily C-type lectin-like 0.0000000000091
Family C-type lectin domain 0.0039
Further Details:      
 
Domain Number 2 Region: 260-291
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000267
Family EGF-type module 0.034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) G1SAL3
Sequence length 490
Comment (tr|G1SAL3|G1SAL3_NOMLE) C-type lectin domain containing 14A {ECO:0000313|Ensembl:ENSNLEP00000022557} KW=Complete proteome; Reference proteome OX=61853 OS=leucogenys). GN=CLEC14A OC=Catarrhini; Hylobatidae; Nomascus.
Sequence
MRPAFALCLLWQALWPGPGGGEHPTADRAGCSPSGACYSLHHATMKRQAAEEACILRGGA
LSTVRAGAELRAVLALLRAGSGPGGGSKDLLFWVALERGRSHCTLENEPLRGFSWLSSDA
GGLESDTLQWVEEPQRSCTARRCAVLQATGGVEPAGWKEMRCHLRANGYLCKYQFEVLCP
APRPGAASNLSYRAPFQLHSAALDFSPPGTKVSAFCRGQVPISITCIADETGARWDKLSG
EVLCPCPGRYLRAGKCTELPNCLDGLGGFACECATGFELGKDGRSCVTSGEGQPTLGGTR
VPTRRPPATATSPVPQRTWSIRVDEKLGEIPLVPEQDNSVTSIPEIPGWGSQSTMSTLQM
SLQAESKATITPSGSVISKFNSTTSSATPPAFDSSSAVVFIFVSTAVVVLVILTMTVLGL
VKLCCHESPSSQPRKESVGPPGLESDPEPTALGSSSAHCTNNGVKVGDCDLRDRAEGALL
AESSLRSGDA
Download sequence
Identical sequences G1SAL3
ENSNLEP00000022557 ENSNLEP00000022557 XP_003263772.1.23891

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]