SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G1SDI9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G1SDI9
Domain Number 1 Region: 147-463
Classification Level Classification E-value
Superfamily Cysteine proteinases 2.29e-127
Family Transglutaminase core 0.00000000761
Further Details:      
 
Domain Number 2 Region: 3-146
Classification Level Classification E-value
Superfamily E set domains 6.3e-41
Family Transglutaminase N-terminal domain 0.00018
Further Details:      
 
Domain Number 3 Region: 618-716
Classification Level Classification E-value
Superfamily Transglutaminase, two C-terminal domains 1.99e-26
Family Transglutaminase, two C-terminal domains 0.00033
Further Details:      
 
Domain Number 4 Region: 505-616
Classification Level Classification E-value
Superfamily Transglutaminase, two C-terminal domains 5.23e-25
Family Transglutaminase, two C-terminal domains 0.00048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) G1SDI9
Sequence length 719
Comment (tr|G1SDI9|G1SDI9_RABIT) Transglutaminase 5 {ECO:0000313|Ensembl:ENSOCUP00000000476} KW=Complete proteome; Reference proteome OX=9986 OS=Oryctolagus cuniculus (Rabbit). GN=TGM5 OC=Oryctolagus.
Sequence
MAQGLEVALTDLQSSRNNVRHHTEEIAVDRLLVRRGQAFLITLYFRNRGFQPGLDNIIFV
AETGPLPDLAKGTRAVFGLGSRGGPSPWIALLESNGATSLEVSLCAPPVAAVGRYLLKVH
IDAFQGSITAYQLGEFILLFNPWCPEDAVYLDSEPQRQEYVVNDYGFIYQGNKNWIRPCP
WNYGQFEENIVDICLELLDKSLNFQVDPATDCALRGSPVYIGRVVCAMINSNDDNGVLNG
NWSENYTDGLNPAEWTGSVAILKQWHATGCQPVRYGQCWVFAAVMCTVMRCLGIPTRVIT
NFDSGHDTDGNLVIDEYYDSTGRILENKKKDSIWNFHVWNECWMARRDLPPGYGGWQLLD
ATPQETSNGLYCCGPASVKAIKEGEVDLKYDTPFAFSMVNADCVSWLVYGGKEQKLHRNT
SAVGSFISTKGVQSDERDDVTENYKYQEGSPEERQVFLKAVQKLKAGKSQGPPGADAPPS
SSTPLSGDSPQSLDIPSLRPGEVAQVSLKFKLLEPPHMGQDINFMLLAINVSPQSKDLKV
NLSAQSLLHDGSPMPPFWQDTAFLTLFPQEVKTYSCIIPYFQYSQYLSTDKLIRISALSE
EKNSLEKILVNKIITLAYPGIMINVLGAAIVNQPLSIQVIFSNPLLEQVANCVLTVEGSG
LFKKQQRVLIGVLKPQHRASITLTTVPFKSGQRQIQANLKSDKFKDIKGYRSVYVDFGL
Download sequence
Identical sequences G1SDI9
ENSOCUP00000000476 XP_008267334.1.1745

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]