SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G1SFW8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G1SFW8
Domain Number 1 Region: 77-386,493-528
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 4.92e-67
Family FAD-linked reductases, N-terminal domain 0.00000108
Further Details:      
 
Domain Number 2 Region: 367-479
Classification Level Classification E-value
Superfamily FAD-linked reductases, C-terminal domain 2.29e-32
Family L-aminoacid/polyamine oxidase 0.0001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) G1SFW8
Sequence length 530
Comment (tr|G1SFW8|G1SFW8_RABIT) Amine oxidase {ECO:0000256|RuleBase:RU362067} KW=Complete proteome; Reference proteome OX=9986 OS=Oryctolagus cuniculus (Rabbit). GN=LOC100353438 OC=Oryctolagus.
Sequence
IPVATFIPGRQAGHRARALERPTPLLSLLTGILILGLLLAAPSCLGYFEDLAKCFQDPDY
DSFLLTAQEGLHASPLPKRVVVVGAGMSGLAAAKTLQDAGHQVTVLEASNHIGGRVITMR
NKEEGWHCELGPMRIPKSHRLVHTYVKKLGLKLNKFIQYDDNTWYLINGQRYRAREVKAN
PELLGYSVKPTEKGKSAMTLFHQSISKLRQNLKMFNCSHLMSLYDSYSTKAYLLKEGMLS
RGAVKMIGDVMNEEAGYYKSLLESLRTGIIFSQSEDFSEIIGGFDQLPYALSATLKPGTI
HLGSKVETVVRDGSEVQVSYRAGEPSSELRKLTADYVLISASAKATRLITFRPPLSADKM
DALRSVHYTSATKVVLACDERFWERDGIRGGVSITDRPSRYIHYPSHQLPSGKGILLASY
TVDDDSLFLTAMTREQVVDLVLDDLAAVHRIPKEELRHMCPSSVVKHWSLDPLTIGAFAE
FTPYQFVDYSRQLFQPEGRIHFAGEHTCLPHAWMDTAIKSGLQAARNIQA
Download sequence
Identical sequences G1SFW8
ENSOCUP00000001440 9986.ENSOCUP00000001440 ENSOCUP00000001440

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]