SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G1SHH1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G1SHH1
Domain Number 1 Region: 5-326,439-471
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 1.59e-48
Family FAD-linked reductases, N-terminal domain 0.00056
Further Details:      
 
Domain Number 2 Region: 312-421
Classification Level Classification E-value
Superfamily FAD-linked reductases, C-terminal domain 4.51e-22
Family L-aminoacid/polyamine oxidase 0.0064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) G1SHH1
Sequence length 477
Comment (tr|G1SHH1|G1SHH1_RABIT) Protoporphyrinogen oxidase {ECO:0000256|RuleBase:RU364052} KW=Complete proteome; Reference proteome OX=9986 OS=Oryctolagus cuniculus (Rabbit). GN=PPOX OC=Oryctolagus.
Sequence
MGRTVVVLGGGISGLAASYHLSRAPRPPKVVLVEGSERLGGWIRSVRGPGGAVFELGPRG
IRPAGALGARTLLMVSELGLDSEVLPVRGDHPAAQNRFLYVGGALHALPTGFRGLLRPSP
PFSKPLFWAGLRELTKPRGKEPDETVHSFVQRRLGPEVASLAMDSLCRGVFAGNSRELSI
RSCFPSLFQAEQTHRSILLGLLLGAGQSPPPDSALIRQARAERWSQWSLRGGLEMLPQAL
DTHLTSRGVQVLRGQPVCRLSLQAGGRWKVSLGDSSLEADHIISAIPAPALSKLLPAEAA
PLARVLSTITAVSVAVVNLQYRGAHLPVQGFGHLVPSSEDPGVLGIVYDSVAFPEQDGSP
PGLRVTVMLGGSWLQTLEASGRVLPQELFQQQAQEAAATQLGLKEPPSHCLVHLLKNCIP
QYTVGHWQKLESAMQFLAAQRLPLTLAGASYEGVAVNDCIESGRQAAASVLGTEPDS
Download sequence
Identical sequences G1SHH1
ENSOCUP00000002076 9986.ENSOCUP00000002076 ENSOCUP00000002076

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]