SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G1SHK5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G1SHK5
Domain Number 1 Region: 43-133
Classification Level Classification E-value
Superfamily Retrovirus capsid dimerization domain-like 2.29e-37
Family SCAN domain 0.0000652
Further Details:      
 
Domain Number 2 Region: 355-411
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 8.33e-24
Family Classic zinc finger, C2H2 0.0039
Further Details:      
 
Domain Number 3 Region: 583-640
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.94e-23
Family Classic zinc finger, C2H2 0.0073
Further Details:      
 
Domain Number 4 Region: 534-584
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.46e-19
Family Classic zinc finger, C2H2 0.0058
Further Details:      
 
Domain Number 5 Region: 769-821
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.65e-17
Family Classic zinc finger, C2H2 0.0062
Further Details:      
 
Domain Number 6 Region: 400-452
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.38e-16
Family Classic zinc finger, C2H2 0.0036
Further Details:      
 
Domain Number 7 Region: 696-749
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000000204
Family Classic zinc finger, C2H2 0.0061
Further Details:      
 
Domain Number 8 Region: 221-262
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 0.0000000000000824
Family KRAB domain (Kruppel-associated box) 0.0035
Further Details:      
 
Domain Number 9 Region: 640-695
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000161
Family Classic zinc finger, C2H2 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) G1SHK5
Sequence length 832
Comment (tr|G1SHK5|G1SHK5_RABIT) Zinc finger with KRAB and SCAN domains 5 {ECO:0000313|Ensembl:ENSOCUP00000002114} KW=Complete proteome; Reference proteome OX=9986 OS=Oryctolagus cuniculus (Rabbit). GN=ZKSCAN5 OC=Oryctolagus.
Sequence
MIMTESRRVADLDSPAEPPQEQEDLLIVKVEEEDCTWMQEYHPPAFETVYQRFRHFQYHE
ASGPREALSQLRVLCCEWLRPELHTKEQILELLVLEQFLTILPEEFQAWVREHHPESGEE
AVAVVESIQRELEERRQQIVACPEVPPQKMVPPGAVQESFSHQLRSVNSQPEHSLTYTSF
SPPSALPVLQVPSLPLKDSQELTTSLLSAGSQKLMKIEDVADVAVSFFLEEWGHLDPSQK
SLYRDGRKENYGNIASMDCEPGANTELTVKQIAEEATSHWMAPGSTERNIPQSQGFAEVS
DLKGMVQRWQVNSAVGKSRQNSSQKRDLSTGKDLNRKQNTNGERGHRCLDCGKFFLQASN
FIQHRRIHTGEKPFTCGECGKSYNQRVHLTQHQRVHTGEKPYKCQVCGKAFRVSSHLVQH
HSVHSGERPYGCNECGKNFGRHSHLIEHLKRHFKEKSQRCSDKRKNTKLNVKKISEFSEA
DMELSGKIQRNVSQVQDFADDYDHQGLVDRKPGIPMKEILGQPSSKRVNCSEVRYIHKKS
STGERPHKCNTCGKSFIQSAHLIQHQRIHTGEKPFRCDECGKSYNQRVHLTQHQRVHTGE
KPYTCHLCGKAFRVRSHLVQHQSVHSGERPFKCNECGKGFGRRSHLAGHLRLHSREKSHQ
CHECGEIFFQYVSLIEHQVLHMGQKSEKNGICEEAYSWNLTVIEDKKIELQEQPYKCDIC
GKTFGYSSDLIQHYRTHTAEKTHKCDICRENVGQCSHKKQHPKICPSTKSHQCDECGRGF
TLKSHLSQHQRIHTGEKPYQCKECGMSFSWSCSLFKHLRSHERTDSINTLSV
Download sequence
Identical sequences G1SHK5
ENSOCUP00000002114 9986.ENSOCUP00000002114 ENSOCUP00000002114

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]