SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G1SJ92 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G1SJ92
Domain Number 1 Region: 582-632
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000000389
Family Classic zinc finger, C2H2 0.01
Further Details:      
 
Domain Number 2 Region: 619-665
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000126
Family Classic zinc finger, C2H2 0.014
Further Details:      
 
Domain Number 3 Region: 107-137
Classification Level Classification E-value
Superfamily SET domain 0.00000785
Family Histone lysine methyltransferases 0.057
Further Details:      
 
Domain Number 4 Region: 149-177
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000809
Family C2HC finger 0.079
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) G1SJ92
Sequence length 716
Comment (tr|G1SJ92|G1SJ92_RABIT) PR/SET domain 13 {ECO:0000313|Ensembl:ENSOCUP00000002791} KW=Complete proteome; Reference proteome OX=9986 OS=Oryctolagus cuniculus (Rabbit). GN=PRDM13 OC=Oryctolagus.
Sequence
AEDPARPSDCLAAAATTMHGTTRAPAASVSADCCIPAGLRLGPVPGTFKLGKYLSDRREP
GPKKKVRMVRGELVDESGGSPLEWIGLIRAARNPQEQTLEAVADLPGGQIFYRALRDVQP
GEELTVWYSNSLAQWFDIPTTATPTHDEKGEERYICWYCWRTFRYPNSLKAHLRFHCVLS
GGGGRAFLHHEHAARPGAAPGADGLGLSLKPSVPDFAAPATAPAGSLRPHPQAPQPSQGC
GARESIKREASSAPSATSPPPGKWGLPKKGKEQPDRHGHFLGIVGGSPAGGGGLAFYPGA
RSAFKPAGLARAATATHGDLYREEGGGKQGAGLALGRLLGGGRTGGRPGSGENPAAGGAG
HHHHHHAHHHHHHPKCLLAGPPPGLPCSGALRGFPLLPGPPEEASAFKHVERAPPATATA
LAGARYAQLPPTPGLPLERCSLPPLEAGGLKAYPGGEFGHLPAVMPAFTVYNGELLYSSP
AAAAYYPLKLHFGGLLKYPESISYFSGPAAAAAAAALSPAEIGSLASIDREIAMHTQQLS
EMAAGKGRGRLDSGTLPPAVAAAGGAGSGGGGCSAGKPKTGHLCLYCGKLYSRKYGLKIH
MRTHTGYKPLKCKVCLRPFGDPSNLNKHIRLHAEGNTPYRCEYCGKVLVRRRDLERHVKS
RHPGQSLLAKAGDGPGAEPGYPPEPGDPKSDDSDVDVCFTDDQSDPEAGGGCERDS
Download sequence
Identical sequences G1SJ92
ENSOCUP00000002791

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]