SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G1SL01 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G1SL01
Domain Number 1 Region: 31-315
Classification Level Classification E-value
Superfamily L domain-like 3.51e-63
Family Ngr ectodomain-like 0.0019
Further Details:      
 
Domain Number 2 Region: 235-479
Classification Level Classification E-value
Superfamily L domain-like 4.76e-37
Family Ngr ectodomain-like 0.011
Further Details:      
 
Domain Number 3 Region: 540-831
Classification Level Classification E-value
Superfamily Family A G protein-coupled receptor-like 2.29e-33
Family Rhodopsin-like 0.0037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) G1SL01
Sequence length 951
Comment (tr|G1SL01|G1SL01_RABIT) Leucine rich repeat containing G protein-coupled receptor 4 {ECO:0000313|Ensembl:ENSOCUP00000003521} KW=Complete proteome; Reference proteome OX=9986 OS=Oryctolagus cuniculus (Rabbit). GN=LGR4 OC=Oryctolagus.
Sequence
MPGPLGLLCFLALGLLGSAGLSGAAPPLCAALCSCDGDRRVDCSGKGLTAVPEGLSAFTQ
ALDISMNNITQLPEDAFKNFPFLEELQLAGNDLSFIHPKALSGLKELKVLTLQNNQLKTV
PSEAIRGLSTLQSLRLDANHITSVPEDSFEGLVQLRHLWLDDNSLTEVPVHPLSHLPTLQ
ALTLALNKISSIPDFAFTNLSSLVVLHLHNNKIKSLSPHCFDGLDNLETLDLNYNNLGEF
PQAIKALPSLKELGFHSNSISVIPDGAFGGNPLLRTIHLYDNPLSFVGNTAFHNLSDLHS
LVIRGASMVQSFPNLTGTVHLESLTLTGTKISKIPSNLCQEQKMLRTLDLSYNNIRDLPS
FNGCHALEEISLQRNQIYQIKEGTFQGLGSLRILDLSRNLIHEIHSRAFAKLGPITNLDM
SFNELTSFPTEGLNGLNQLKLVGNFKLKEALAAKDFVNLRSLSVPYAYQCCAFWGCDSYA
NINTEDNSLQDHPVTKEKGTADAANVTSSAENEEHSQIIIHCTPSTGAFKPCEYLLGSWM
IRLTVWFIFLVALSFNLLVTLTTFASCTSLPSSKLFIGLISVSNLFMGIYSGILTFLDAV
SWGRFAEFGIWWETGSGCKVAGFLAVFSSESAIFLLVLAAVERSLSAKEIMKNGKSNHLK
QFRVAALFAFLGAAVAGCFPLFHRGEYSASPLCLPFPTGETPSLGFTVTLVLLNSLAFLL
MAIIYTKLYCNLEKEDLSENSQSSMIKHVAWLIFTNCIFFCPVAFFSFAPLITAISISPE
IMKSVTLIFFPLPACLNPVLYVFFNPKFKEDWKLLKRRLTKKNGSVSVSISSQGGCVEQD
FYYDCGMYSHLQGNLTVCDCCESFLLTKPVSCKHLIKSHSCPALAVASCQRPEGYWSDCG
TQSAHSDYADEEDSFVSDSSDQVQACGRACFYQSRGFPLVRYAYNLPRVKD
Download sequence
Identical sequences G1SL01
XP_002709069.1.1745 ENSOCUP00000003521 ENSOCUP00000022840 9986.ENSOCUP00000003521

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]