SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G1SL39 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G1SL39
Domain Number 1 Region: 23-198
Classification Level Classification E-value
Superfamily Lysozyme-like 2.18e-26
Family G-type lysozyme 0.00000524
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) G1SL39
Sequence length 198
Comment (tr|G1SL39|G1SL39_RABIT) Lysozyme g-like protein {ECO:0000256|PIRNR:PIRNR001065} KW=Complete proteome; Reference proteome OX=9986 OS=Oryctolagus cuniculus (Rabbit). GN=LYG2 OC=Oryctolagus.
Sequence
GTSRASSPFLHSINPHLHPRLYHGCYGDIMTMETSGALCNIKSLLHCGIRGSEMFAEMDL
RTLKPYQTLIKEVGQRHCVDPALVAAIISRESHGGAVLQNGWDHRGLKFGLMQLDKQICH
PIGAWDSKEHLLQGVEILADRIKAIQKKFPTWNMVQHLKGGLSAFKSGIEGIDTPADIDD
DYVDDVIARAKFYRHHGY
Download sequence
Identical sequences G1SL39
9986.ENSOCUP00000003563 ENSOCUP00000003563 ENSOCUP00000003563

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]