SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G1SLW6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G1SLW6
Domain Number 1 Region: 104-145
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 9.98e-17
Family LIM domain 0.0068
Further Details:      
 
Domain Number 2 Region: 37-83
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.00000000000000416
Family LIM domain 0.00072
Further Details:      
 
Domain Number 3 Region: 146-188
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.0000000000000214
Family LIM domain 0.0011
Further Details:      
 
Domain Number 4 Region: 9-35
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.000000000155
Family LIM domain 0.0065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) G1SLW6
Sequence length 194
Comment (tr|G1SLW6|G1SLW6_RABIT) Cysteine and glycine rich protein 3 {ECO:0000313|Ensembl:ENSOCUP00000003870} KW=Complete proteome; Reference proteome OX=9986 OS=Oryctolagus cuniculus (Rabbit). GN=CSRP3 OC=Oryctolagus.
Sequence
MPNWGGGAKCGACEKTVYHAEEIQCNGRSFHKTCFHCMACRKALDSTTVAAHESEIYCKV
CYGRRYGPKGIGYGQGAGCLSTDTGEHLGLQFQQSPKPARSATTSNPSKFTAKFGESEKC
PRCGKSVYAAEKVMGGGKPWHKTCFRCAICGKSLESTNVTDKDGELYCKVCYAKNFGPTG
IGFGGLTQQVEKKE
Download sequence
Identical sequences A0A1U7UA30 A0A250XW36 A0A2J8UQS5 A0A2K5C6U8 A0A2K5SIF8 E2R9P5 F6U8R3 G1S7X9 G1SLW6 I3MCC7 M3YR35
ENSCAFP00000013877 ENSTBEP00000010063 ENSMPUP00000013794 ENSCJAP00000012674 9600.ENSPPYP00000003932 9615.ENSCAFP00000013877 9986.ENSOCUP00000003870 ENSCJAP00000012674 ENSNLEP00000021618 ENSMPUP00000013794 ENSTSYP00000013244 ENSTSYP00000013244 ENSSTOP00000007906 XP_002708982.1.1745 XP_002755142.1.60252 XP_002822010.1.23681 XP_003254358.1.23891 XP_004752173.1.14098 XP_005336002.1.77405 XP_006164909.1.99106 XP_006164910.1.99106 XP_008069129.1.4292 XP_009244802.1.23681 XP_012311936.1.9421 XP_012311937.1.9421 XP_015333183.1.40921 XP_015333184.1.40921 XP_017381383.1.71028 XP_020026883.1.5219 XP_852328.1.84170 ENSNLEP00000021618 ENSOCUP00000003870 ENSTBEP00000010063 ENSOCUP00000003870 ENSCAFP00000013877 ENSSTOP00000007906

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]