SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G1SMZ2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G1SMZ2
Domain Number 1 Region: 32-390,431-457
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 9.13e-47
Family FAD/NAD-linked reductases, N-terminal and central domains 0.074
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) G1SMZ2
Sequence length 580
Comment (tr|G1SMZ2|G1SMZ2_RABIT) Pyridine nucleotide-disulphide oxidoreductase domain 2 {ECO:0000313|Ensembl:ENSOCUP00000004324} KW=Complete proteome; Reference proteome OX=9986 OS=Oryctolagus cuniculus (Rabbit). GN=PYROXD2 OC=Oryctolagus.
Sequence
ADMAARALRRAAGPSPCPAWRQAHAVGKGRLKPEYNAVVIGAGHNGLVAAAYLQRLGVNT
VVFERRHVIGGAAVTEEIVPGFKFSRASYLLSLLRPQIYTDLELKKHGLRLHLRNPHSFT
PMLKRAWGAGAQVPPAGHRRVENQKQIARFSQKENEAFPRYEEFLSRLILAIDPLLDAAP
VDLAALQQGRLLQRLKSLSTLMPLLKAGRILGAQLPQYYQVLVAPISKVLDHWFESEPLK
ATLATDAVIGAMMSPHTPGSGYVLLHHVMGALEGRQGAWGYVQGGMGALSEAIASSATAH
GASIFTEKTVVRVQVNSEGRVQGVVLQDGEEVRSKVVLSNASPQITFLKLTPQEWLPEAF
VKRISQLDTQSPVTKINVAVDRLPSFLAAPNAPSGQPLPHHQCSIHLNCEDIPVLHQAFE
DAVAGLPSRRPMIELCIPSSLDPTLAPRGCHVISLFTQYTPYTLAAGKQWDELEKNAYAD
RVFDCIEAYAPGFKGSVLGRDILTPPDLERIFGLPGGNIFHGAMSLEQLYFARPVPLHSS
YRSPLQGLYLCGSGAHPGGGVMGAAGRNAAHVVFEDLKNK
Download sequence
Identical sequences G1SMZ2
9986.ENSOCUP00000004324 ENSOCUP00000004324 ENSOCUP00000020373

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]