SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G1SQG9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G1SQG9
Domain Number 1 Region: 303-369
Classification Level Classification E-value
Superfamily Small-conductance potassium channel 3.79e-19
Family Small-conductance potassium channel 0.00069
Further Details:      
 
Domain Number 2 Region: 180-267
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 0.000000000000314
Family Voltage-gated potassium channels 0.0025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) G1SQG9
Sequence length 421
Comment (tr|G1SQG9|G1SQG9_RABIT) Potassium calcium-activated channel subfamily N member 4 {ECO:0000313|Ensembl:ENSOCUP00000005346} KW=Complete proteome; Reference proteome OX=9986 OS=Oryctolagus cuniculus (Rabbit). GN=KCNN4 OC=Oryctolagus.
Sequence
MGGELVPGLGALRRRKRLLEQEKWLAGWALALAGIGIGLMVLHAEMLWFGGCPWALYLFL
VKCMISGSTFLLLCLIVAFHAKEVQLFMTDNALRDWRVALTGRQAAQILLELAVCGLHPA
PVRGPPCAQGSGTPAWPGFLDQGEALLSLAMLLRLYLVPRAVLLRSGVLLNASYRSIGAL
NQVRFRHWFVAKLYMNTHPGRLLLGLTLGLWLTTAWVLSVAERQAVNATGHLSDTLWLIP
ITFLTIGYGDVVPGTVWGKIVCLCTGVMVSVALQPPETRRRLRSGQCWAVSIALSDGQVN
HRETPSGASSCLEEPWXMYYKHTRRKESGATRRHQRRLLAAIHTFRQVRLKHRKLREQVN
SMVDISKMHMILSDLQLGLSSSHQALEKRIDALAGKLDALAELLGAALGPQQRPAPSQEA
T
Download sequence
Identical sequences G1SQG9
ENSOCUP00000005346 9986.ENSOCUP00000005346 ENSOCUP00000005346

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]