SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G1SR36 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G1SR36
Domain Number 1 Region: 268-444
Classification Level Classification E-value
Superfamily ThrRS/AlaRS common domain 2.09e-24
Family Threonyl-tRNA synthetase (ThrRS), second 'additional' domain 0.0069
Further Details:      
 
Domain Number 2 Region: 217-262
Classification Level Classification E-value
Superfamily TGS-like 0.0000425
Family TGS domain 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) G1SR36
Sequence length 471
Comment (tr|G1SR36|G1SR36_RABIT) Mitochondrial ribosomal protein L39 {ECO:0000313|Ensembl:ENSOCUP00000005605} KW=Complete proteome; Reference proteome OX=9986 OS=Oryctolagus cuniculus (Rabbit). GN=MRPL39 OC=Oryctolagus.
Sequence
MLTGQMDATAQAPARPSRGALPAQLRGKPELEEAMGRREPGDSGGCGARGTQPLPGRRPV
SLTAHEVLGHPSRPWNTQGRGACDSEAQRRPLMAARSPERPERNCRAEPRCAFRVSGGRK
AGEDRRAAVPTAAVKAMAVGVRMLRLCRVVPGCGAGWRWIATAAAQLTPPELTEMRNDLF
NKEKKRQLSLTPRTEKIEVKHVGKTDPGAVFVMNKNVSTPYSCAMHLSEWYCRKSILALV
DGQPWDMYKPLTKSCEIEFLTFKDRDPGEVNKAYWRSCAMMMGCVIERAFKDEYVVSLVG
APEVPVIAGAFCYDVVLDKKLDEWMPTKENLRSFTKDVHALIYKDLPFETLEVEAKVALE
IFQHNKYKIDFIEEKASQNPERIVKLHRIGDFIDVSEGPLIPRTGICFQYEVSAVHNLHP
TQPSLVRRFQGLSLPVHLRAHFTIWDKLLERSRKLVTANQSKRTEENVTTQ
Download sequence
Identical sequences G1SR36
ENSOCUP00000005605

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]